• Featured Product
  • KD/KO Validated

REEP5 Monoclonal antibody, PBS Only (Capture)

REEP5 Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 68119-1-PBS
Clone No.1H8D8

Host / Isotype

Mouse / IgG1

Reactivity

human, pig

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

1H8D8, C5orf18, DP1, Polyposis locus protein 1, Protein TB2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68119-1-PBS targets REEP5 as part of a matched antibody pair:

MP50780-1: 68119-1-PBS capture and 68119-2-PBS detection (validated in Cytometric bead array)

MP50780-2: 68119-1-PBS capture and 68119-3-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6229

Product name: Recombinant human REEP5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-189 aa of BC065926

Sequence: MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST

Predict reactive species
Full Name receptor accessory protein 5
Calculated Molecular Weight 21 kDa
Observed Molecular Weight18 kDa
GenBank Accession NumberBC065926
Gene Symbol REEP5
Gene ID (NCBI) 7905
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ00765
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

REEP5 (receptor expression-enhancing protein 5), also named as C5orf18, DP1, or TB2, is a membrane protein belonging to the DP1/Yop1p protein family. All REEP proteins contain a conserved TB2/DP1, HVA22 domain, which is involved in intracellular trafficking and secretion (PMID: 19123125). REEP5 is expressed in circumvallate papillae and testis, and may have the function to influence functional cell surface expression of taste receptors (PMID: 16720576). REEP5 can interact with atlastins (ATL1 and ATL2), which are involved in modulating the structure of the ER network (PMID: 19665976).

Loading...
||
New chat

Able

正在加载,请稍候...