RFC3 Monoclonal antibody, PBS Only

RFC3 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 68290-1-PBS
Clone No.2G3A8

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat

Applications

WB, Indirect ELISA

A1 38 kDa subunit, Activator 1 38 kDa subunit, Activator 1 subunit 3, Replication factor C subunit 3, RF C 38 kDa subunit, RFC3, RFC38

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68290-1-PBS targets RFC3 in WB, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28365

Product name: Recombinant human RFC3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-356 aa of BC000149

Sequence: MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF

Predict reactive species
Full Name replication factor C (activator 1) 3, 38kDa
Calculated Molecular Weight 40 aa, 6 kDa
Observed Molecular Weight 38 kDa
GenBank Accession NumberBC000149
Gene Symbol RFC3
Gene ID (NCBI) 5983
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP40938
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

RFC3, also known as RFC38, is a 356 amino acid protein, which localizes in the nucleus. Replication factor C (RFC) is a component of the eukaryotic DNA polymerase. In all eukaryotic cell cycles, it is essential for DNA duplication, DNA injury repair, and checkpoint control. RFC consists of five subunits (RFC1-5). The interrelationships between RFC2, RFC3, and the c-MYC oncogene (transcription factor) can induce cell division and proliferation. RFC3 is associated with liver, breast, esophageal and ovarian cancer, and serves a critical role in cellular proliferation, invasion, and metastasis. RFC3 exists in two isoforms with molecular weights of 34 kDa and 38-40 kDa.

Loading...
||
New chat

Able

正在加载,请稍候...