RFC3 Monoclonal antibody, PBS Only

• 

  WB analysis using 68290-1-Ig (same clone as 68290-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68290-1-Ig (RFC3 antibody) at dilution of 1:10000 and incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68290-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 68290-1-Ig (same clone as 68290-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 68290-1-Ig (RFC3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68290-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 68290-1-Ig (same clone as 68290-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 68290-1-Ig (RFC3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68290-1-PBS in a different storage buffer formulation.

RFC3 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68290-1-PBS

Clone No.2G3A8

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat

Applications

WB, Indirect ELISA

Synonyms

A1 38 kDa subunit, Activator 1 38 kDa subunit, Activator 1 subunit 3, Replication factor C subunit 3, RF C 38 kDa subunit, RFC3, RFC38

---

Product Information

68290-1-PBS targets RFC3 in WB, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28365

  Product name: Recombinant human RFC3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-356 aa of BC000149

  Sequence: MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF

• Full Name: replication factor C (activator 1) 3, 38kDa
• Calculated Molecular Weight: 40 aa, 6 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC000149
• Gene Symbol: RFC3
• Gene ID (NCBI): 5983
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P40938
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RFC3, also known as RFC38, is a 356 amino acid protein, which localizes in the nucleus. Replication factor C (RFC) is a component of the eukaryotic DNA polymerase. In all eukaryotic cell cycles, it is essential for DNA duplication, DNA injury repair, and checkpoint control. RFC consists of five subunits (RFC1-5). The interrelationships between RFC2, RFC3, and the c-MYC oncogene (transcription factor) can induce cell division and proliferation. RFC3 is associated with liver, breast, esophageal and ovarian cancer, and serves a critical role in cellular proliferation, invasion, and metastasis. RFC3 exists in two isoforms with molecular weights of 34 kDa and 38-40 kDa.