RFX2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RFX2 Polyclonal antibody, PBS Only (12622-1-PBS)

• 

  WB analysis using 12622-1-AP (same clone as 12622-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12622-1-AP (RFX2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12622-1-PBS in a different storage buffer formulation.

• 

  IP experiment of THP-1 using 12622-1-AP (same clone as 12622-1-PBS)

  IP result of anti-RFX2 (IP:12622-1-AP, 4ug; Detection:12622-1-AP 1:1000) with THP-1 cells lysate 1920 ug. This data was developed using the same antibody clone with 12622-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 12622-1-AP (same clone as 12622-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 12622-1-AP (RFX2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12622-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat testis using 12622-1-AP (same clone as 12622-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 12622-1-AP (RFX2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12622-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat testis using 12622-1-AP (same clone as 12622-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 12622-1-AP (RFX2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12622-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 12622-1-AP (same clone as 12622-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 12622-1-AP (RFX2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12622-1-PBS in a different storage buffer formulation.

RFX2 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 12622-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

DNA binding protein RFX2, DNA-binding protein RFX2, Regulatory factor X 2

---

Product Information

12622-1-PBS targets RFX2 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3310

  Product name: Recombinant human RFX2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 424-723 aa of BC028579

  Sequence: VLPKDKLISLCQCDPILRWMRSCDHILYQALVEILIPDVLRPVPSTLTQAIRNFAKSLEGWLTNAMSDFPQQVIQTKVGVVSAFAQTLRRYTSLNHLAQAARAVLQNTSQINQMLSDLNRVDFANVQEQASWVCQCEESVVQRLEQDFKLTLQQQSSLDQWASWLDSVVTQVLKQHAGSPSFPKAAQQFLLKWSFYSSMVIRDLTLRSAASFGSFHLIRLLYDEYMFYLVEHRVAEATGETPIAVMGEFNDLASLSLTLLDKDDMGDEQRGSEAGPDARSLGEPLVKRERSDPNHSLQGI

• Full Name: regulatory factor X, 2 (influences HLA class II expression)
• Calculated Molecular Weight: 723 aa, 80 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC028579
• Gene Symbol: RFX2
• Gene ID (NCBI): 5990
• RRID: AB_3741832
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48378
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RFX2 is a key regulator of ciliogenesis in vertebrates, and knockdown of Rfx2 causes defects in neural tube closure and in left-right axis patterning (PMID: 26248850). RFX2 expression is greatly enhanced in adult testis and that RFX2 is equally prominent in highly enriched populations of late pachytene spermatocytes and round spermatids(PMID: 22227339). RFX2 is also required for the development of left-right asymmetry, and motile cilia on RFX2-expressing cells are sufficient to establish adequate fluid flow across the COA to direct normal LR development in mouse (PMID: 22233545).