CoraLite® Plus 488-conjugated RGS4 Monoclonal antibody

RGS4 Monoclonal Antibody for WB
Cat No. CL488-66441
Clone No.1E2E2

Host / Isotype

Mouse / IgG1

Reactivity

human, rat, mouse, pig

Applications

WB

DKFZp761F1924, RGP4, RGS4, SCZD9

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inC6 cells, Neuro-2a cells, Raji cells, SH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66441 targets RGS4 in WB applications and shows reactivity with human, rat, mouse, pig samples.

Tested Reactivity human, rat, mouse, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6029

Product name: Recombinant human RGS4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-205 aa of BC051869

Sequence: MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA

Predict reactive species
Full Name regulator of G-protein signaling 4
Calculated Molecular Weight 23 kDa
Observed Molecular Weight 34 kDa
GenBank Accession NumberBC051869
Gene Symbol RGS4
Gene ID (NCBI) 5999
RRIDAB_3084246
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP49798
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Regulator of G protein signaling (RGS) proteins are a large family of highly diverse, multifunctional signaling proteins. RGS4 is one of seven members of a classic R4 RGS protein that accelerates the GTPase activity of the Gai/o and Gaq/11 family members. RGS4 is highly expressed in multiple brain regions including the cerebral cortex, amygdala, hippocampus, and striatum. Extensive studies have demonstrated that RGS4 plays an important role in regulating smooth muscle contraction, cardiomyocyte development, neural plasticity and psychiatric disorders.

Protocols

Product Specific Protocols
WB protocol for CL Plus 488 RGS4 antibody CL488-66441Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...