RGS5 Polyclonal antibody, PBS Only

• 

  WB analysis using 11590-1-AP (same clone as 11590-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11590-1-AP (RGS5 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11590-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 11590-1-AP (same clone as 11590-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 11590-1-AP (RGS5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11590-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 11590-1-AP (same clone as 11590-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 11590-1-AP (RGS5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11590-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 11590-1-AP (same clone as 11590-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 11590-1-AP (RGS5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11590-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 11590-1-AP (same clone as 11590-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 11590-1-AP (RGS5 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11590-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human skeletal muscle using 11590-1-AP (same clone as 11590-1-PBS)

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 11590-1-AP (RGS5 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11590-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 11590-1-AP (same clone as 11590-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 11590-1-AP (RGS5 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11590-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 11590-1-AP (same clone as 11590-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 11590-1-AP (RGS5 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11590-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 11590-1-AP (same clone as 11590-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 11590-1-AP (RGS5 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11590-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 11590-1-AP (same clone as 11590-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using RGS5 antibody (11590-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11590-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 11590-1-AP (same clone as 11590-1-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human RGS5 (11590-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 11590-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RGS5 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 11590-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

Regulator of G-protein signaling 5

---

Product Information

11590-1-PBS targets RGS5 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2196

  Product name: Recombinant human RGS5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-181 aa of BC030059

  Sequence: MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK

• Full Name: regulator of G-protein signaling 5
• Calculated Molecular Weight: 181 aa, 21 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC030059
• Gene Symbol: RGS5
• Gene ID (NCBI): 8490
• RRID: AB_10644290
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15539
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RGS5 inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. It binds to G(i)-alpha and G(o)-alpha, but not to G(s)-alpha. The 42kd band recognized by this antibody is a RGS5-RGS5 dimer. (Pubmed:17762159)