CoraLite® Plus 488-conjugated RIAM,APBB1IP Monoclonal antibody

RIAM,APBB1IP Monoclonal Antibody for IF/ICC
Cat No. CL488-67143
Clone No.2F8A2

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse

Applications

IF/ICC

APBB1 interacting protein 1, APBB1IP, APBB1IP,RIAM, INAG1, PREL 1, PREL1, Proline rich EVH1 ligand 1, Proline rich protein 73, RARP 1, RARP1, RIAM, RIAM,APBB1IP

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inJurkat cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67143 targets RIAM,APBB1IP in IF/ICC applications and shows reactivity with Human, Mouse samples.

Tested Reactivity Human, Mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag4602

Product name: Recombinant human RIAM,APBB1IP protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-172 aa of BC035636

Sequence: MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATGISQYEDDLPPPPADPVLDLPLPPPPPEPLSQVSMWDQRWQDHQPLLPITDVP

Predict reactive species
Full Name amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein
Calculated Molecular Weight 666 aa, 73 kDa
Observed Molecular Weight 100 kDa
GenBank Accession NumberBC035636
Gene Symbol RIAM
Gene ID (NCBI) 54518
RRIDAB_3084315
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ7Z5R6
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

APBB1IP gene encodes a Rap1-GTP-interacting adapter molecule (RIAM) which is an important protein in Rap1-mediated integrin activation and adhesion. Rap1 is a small GTPase frequently activated in tumors such as melanoma and prostate cancer. RIAM is widely expressed with high expression in thymus, spleen, lymph node, bone marrow and peripheral leukocytes. RIAM may function in the signal transduction from Ras activation to actin cytoskeletal remodeling. The observed molecular weight of RIAM is about 100 kDa.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 RIAM,APBB1IP antibody CL488-67143Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...