CoraLite® Plus 488-conjugated RIF1 Polyclonal antibody

• 

  IF Staining of HEK-293 using CL488-30119

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using CoraLite® Plus 488 RIF1 antibody (CL488-30119) at dilution of 1:200.

• 

  IF Staining of HeLa using CL488-30119

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 488 RIF1 antibody (CL488-30119) at dilution of 1:200.

RIF1 Polyclonal Antibody for IF/ICC

Cat No. CL488-30119

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

IF/ICC

Synonyms

DKFZp434D1026, DKFZp781N1478, FLJ12870, RIF1

---

Tested Applications

• Positive IF/ICC detected in: HEK-293 cells, HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-30119 targets RIF1 in IF/ICC applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32422

  Product name: Recombinant human RIF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2277-2472 aa of NM_001177663.1

  Sequence: SEMAKESIPCPTESVYPPLVNCVAPVDIILPQITSNMWARGLGQLIRAKNIKTIGDLSTLTASEIKTLPIRSPKVSNVKKALRIYHEQQVKTRGLEEIPVFDISEKTVNGIENKSLSPDEERLVSDIIDPVALEIPLSKNLLAQISALALQLDSEDLHNYSGSQLFEMHEKLSCMANSVIKNLQSRWRSPSHENSI

• Full Name: RAP1 interacting factor homolog (yeast)
• Calculated Molecular Weight: 274 kDa
• Observed Molecular Weight: 300 kDa
• GenBank Accession Number: NM_001177663.1
• Gene Symbol: RIF1
• Gene ID (NCBI): 55183
• RRID: AB_3084125
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5UIP0
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

RIF1 (Rap1-interacting factor 1) is a multifunctional chromosome stability protein implicated in controlling DNA replication and repair. Human RIF1 can interact with protein phosphatase 1 (PP1) and the interaction is crucial for controlling DNA replication by limiting phosphorylation of the MCM complex (PMID: 28077461). RIF1 also acts with PP1 to protect nascent DNA from overdegradation at stalled replication forks (PMID: 31141682). RIF1 promotes non-homologous end joining (NHEJ) in double strand break (DSB) repair (PMID: 30443189). Research studies show that RIF1 is overexpressed in breast cancer tissues and is upgraded in NSCLC tissues (PMID: 30237512).