RNF128 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RNF128 Polyclonal antibody, PBS Only (26015-1-PBS)

• 

  WB analysis using 26015-1-AP (same clone as 26015-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26015-1-AP (RNF128 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26015-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 26015-1-AP (same clone as 26015-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 26015-1-AP (RNF128 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26015-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 26015-1-AP (same clone as 26015-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 26015-1-AP (RNF128 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26015-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RNF128 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 26015-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

E3 ubiquitin-protein ligase RNF128, EC:2.3.2.27, GRAIL, RING finger protein 128, RING-type E3 ubiquitin transferase RNF128

---

Product Information

26015-1-PBS targets RNF128 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22834

  Product name: Recombinant human RNF128 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 333-428 aa of BC063404

  Sequence: DGSVSLQVPVSNEISNSASSHEEDNRSETASSGYASVQGTDEPPLEEHVQSTNESLQLVNHEANSVAVDVIPHVDNPTFEEDETPNQETAVREIKS

• Full Name: ring finger protein 128
• Calculated Molecular Weight: 428 aa, 47 kDa
• Observed Molecular Weight: 40-47 kDa, 66-70 kDa
• GenBank Accession Number: BC063404
• Gene Symbol: RNF128
• Gene ID (NCBI): 79589
• RRID: AB_2880336
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TEB7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.