CoraLite® Plus 488-conjugated RNF135 Polyclonal antibody

RNF135 Polyclonal Antibody for IF/ICC
Cat No. CL488-25061

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

RIG-I E3 ubiquitin ligase, RIG I E3 ubiquitin ligase, REUL, L13, EC:2.3.2.27

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inPC-12 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-25061 targets RNF135 in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18821

Product name: Recombinant human RNF135 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-210 aa of BC005084

Sequence: MAGLGLGSAVPVWLAEDDLGCIICQGLLDWPATLPCGHSFCRHCLEALWGARDARRWACPTCRQGAAQQPHLRKNTLLQDLADKYRRAAREIQAGSDPAHCPCPGSSSLSSAAARPRRRPELQRVAVEKSITEVAQELTELVEHLVDIVRSLQNQRPLSESGPDNELSILGKENSWKPRLPPHAHCLTRATLHSGELLGLLSGPSIQPLT

Predict reactive species
Full Name ring finger protein 135
Calculated Molecular Weight 432 aa, 48 kDa
Observed Molecular Weight 48 kDa
GenBank Accession NumberBC005084
Gene Symbol RNF135
Gene ID (NCBI) 84282
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8IUD6
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Ring finger protein 135 (RNF135), located on chromosome 17q11.2, is a RING finger domain-containing E3 ubiquitin ligase that was identified as a bio-marker and therapy target of glioblastoma (PMID: 26856755). RNF135 facilitates RIG-I C-terminal ubiquitination to up-regulate RIG-I-mediated IFN signaling and suppress viral replication. This antibody can detect a band at 48 kDa as predicted.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 RNF135 antibody CL488-25061Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...