RNF180 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RNF180 Polyclonal antibody, PBS Only (30941-1-PBS)

• 

  WB analysis using 30941-1-AP (same clone as 30941-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30941-1-AP (RNF180 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30941-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 30941-1-AP (same clone as 30941-1-PBS)

  WB result of RNF180 antibody (30941-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-RNF180 transfected A549 cells. This data was developed using the same antibody clone with 30941-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 30941-1-AP (same clone as 30941-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 30941-1-AP (RNF180 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30941-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 30941-1-AP (same clone as 30941-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using RNF180 antibody (30941-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 30941-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RNF180 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 30941-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

E3 ubiquitin-protein ligase RNF180, EC:2.3.2.27, RINES, RING finger protein 180, RNF 180

---

Product Information

30941-1-PBS targets RNF180 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34138

  Product name: Recombinant human RNF180 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 220-416 aa of BC101277

  Sequence: ATRAFHRKSHSLDLNISEKLTLLPTLYEIHSKTTAYSRLNETQPIDLSGLPLQSSKNSYSFQNPSSFDPSMLLQRFSVAPHETQTQRGGEFQCGLEAASVYSDHTNTNNLTFLMDLPSAGRSMPEASDQEEHLSPLDFLHSANFSLGSINQRLNKRERSKLKNLRRKQRRRERWLQKQGKYSGVGLLDHMVSIYLLI

• Full Name: ring finger protein 180
• Calculated Molecular Weight: 592 aa, 68 kDa
• Observed Molecular Weight: 70 kDa,48kDa
• GenBank Accession Number: BC101277
• Gene Symbol: RNF180
• Gene ID (NCBI): 285671
• RRID: AB_3669788
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q86T96
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.