• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated ROCK2 Monoclonal antibody

ROCK2 Monoclonal Antibody for WB
Cat No. CL594-66633
Clone No.1C7B8

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Rat, Mouse

Applications

WB

KIAA0619, p164 ROCK 2, Rho kinase 2, ROCK2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66633 targets ROCK2 in WB applications and shows reactivity with Human, Rat, Mouse samples.

Tested Reactivity Human, Rat, Mouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag16330

Product name: Recombinant human ROCK2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-180 aa of BC111801

Sequence: MEIDMTYQLKVIQQSLEQEEAEHKATKARLADKNKIYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSLLDCDLKQSQQKINELLKQKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMNLEKQNAELRKERQDADGQMKELQDQ

Predict reactive species
Full Name Rho-associated, coiled-coil containing protein kinase 2
Calculated Molecular Weight 77 kDa, 161 kDa
Observed Molecular Weight 161 kDa
GenBank Accession NumberBC111801
Gene Symbol ROCK2
Gene ID (NCBI) 9475
RRIDAB_2920017
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO75116
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

ROCK2 is a serine/threonine kinase that regulates cytokinesis, smooth muscle contraction, the formation of actin stress fibers and focal adhesions, and the activation of the c-fos serum response element. It is an isozyme of ROCK1, is a target for the small GTPase Rho. ROCK2 is localized in both cytoplasm and nucleus, and the nucleus-localized ROCK2 can target p300 for phosphorylation to regulate its acetyltransferase activity (PMID:16574662).This antibody is specific to ROCK2.

Protocols

Product Specific Protocols
WB protocol for CL594 ROCK2 antibody CL594-66633Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...