ROMO1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ROMO1 Polyclonal antibody, PBS Only (24200-1-PBS)

• 

  WB analysis of HEK-293 using 24200-1-AP (same clone as 24200-1-PBS)

  WB result of ROMO1 antibody (24200-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-ROMO1 transfected HEK-293 cells. This data was developed using the same antibody clone with 24200-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 24200-1-AP (same clone as 24200-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 24200-1-AP (ROMO1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 24200-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 24200-1-AP (same clone as 24200-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 24200-1-AP (ROMO1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 24200-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 24200-1-AP (same clone as 24200-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas using 24200-1-AP (ROMO1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 24200-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 24200-1-AP (same clone as 24200-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas using 24200-1-AP (ROMO1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 24200-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ROMO1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 24200-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

C20orf52, Epididymis tissue protein Li 175, Glyrichin, Mitochondrial targeting GxxxG motif protein, MTGM

---

Product Information

24200-1-PBS targets ROMO1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20368

  Product name: Recombinant human ROMO1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-79 aa of BC008488

  Sequence: MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC

• Full Name: reactive oxygen species modulator 1
• Calculated Molecular Weight: 79 aa, 8 kDa
• Observed Molecular Weight: 6-10 kDa
• GenBank Accession Number: BC008488
• Gene Symbol: ROMO1
• Gene ID (NCBI): 140823
• RRID: AB_2879453
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P60602
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.