Tested Applications
| Positive WB detected in | Y79 cells, HeLa cells, PC-3 cells |
| Positive IHC detected in | mouse eye tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse eye tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17939-1-AP targets RPE65 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12356 Product name: Recombinant human RPE65 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 204-533 aa of BC075036 Sequence: YNIVKIPPLQADKEDPISKSEIVVQFPCSDRFKPSYVHSFGLTPNYIVFVETPVKINLFKFLSSWSLWGANYMDCFESNETMGVWLHIADKKRKKYLNNKYRTSPFNLFHHINTYEDNGFLIVDLCCWKGFEFVYNYLYLANLRENWEEVKKNARKAPQPEVRRYVLPLNIDKADTGKNLVTLPNTTATAILCSDETIWLEPEVLFSGPRQAFEFPQINYQKYCGKPYTYAYGLGLNHFVPDRLCKLNVKTKETWVWQEPDSYPSEPIFVSHPDALEEDDGVVLSVVVSPGAGQKPAYLLILNAKDLSEVARAEVEINIPVTFHGLFKKS Predict reactive species |
| Full Name | retinal pigment epithelium-specific protein 65kDa |
| Calculated Molecular Weight | 61 kDa |
| Observed Molecular Weight | 65 kDa, 61 kDa |
| GenBank Accession Number | BC075036 |
| Gene Symbol | RPE65 |
| Gene ID (NCBI) | 6121 |
| RRID | AB_2285290 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q16518 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RPE65(Retinal pigment epithelium-specific 65 kDa protein) is also named as retinoid isomerohydrolase with the calculated molecular weight og 61 kDa and belongs to the carotenoid oxygenase family. It is a microsomal protein with isomerase activity in the retinoid visual cycle that playing a role in the isomerisation of all-trans (vitamin A) to 11-cis retinal, the chromophore of the visual pigments. It also might be involved in retinoid uptake of keratinocytes.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RPE65 antibody 17939-1-AP | Download protocol |
| IHC protocol for RPE65 antibody 17939-1-AP | Download protocol |
| WB protocol for RPE65 antibody 17939-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The RPE65 Polyclonal antibody (Cat# 17939-1-AP) has 25 citations spanning 21 journals, including ACS Nano, Cell Reports, Redox Biology, Investigative Ophthalmology & Visual Science, Journal of Biological Chemistry, FASEB Journal, and Experimental Eye Research. Research fields covered include retinal pigment epithelium biology, diabetic retinopathy, ferroptosis, age-related macular degeneration, retinal angiogenesis, the visual cycle, retinitis pigmentosa, gene therapy, and RPE cell differentiation. Applications cited include WB, IF, and IHC across human, mouse, rat, pig, and zebrafish species.
| Species | Application | Title |
|---|---|---|
ACS Nano Disulfide-Appended siRNA Nanoeyedrops: Noninvasive Gene Therapy for Targeting Retinal Angiogenesis. | ||
Redox Biol Glia maturation factor-β induces ferroptosis by impairing chaperone-mediated autophagic degradation of ACSL4 in early diabetic retinopathy. | ||
Adv Sci (Weinh) A Nucleic Acid-Based LYTAC Plus Platform to Simultaneously Mediate Disease-Driven Protein Downregulation | ||
Acta Biomater The construction of retinal pigment epithelium (RPE) sheets with enhanced RPE characteristics and cilium assembly using iPS conditioned medium and small incision lenticule extraction derived lenticules. | ||
Int J Mol Med Klotho attenuates epithelial‑mesenchymal transition of retinal pigment epithelial cells in subretinal fibrosis by suppressing the ERK1/2 and Wnt/β‑catenin signaling pathways | ||
Mol Med CRISPR-cas9 screening identified lethal genes enriched in Hippo kinase pathway and of predictive significance in primary low-grade glioma
|
Reviews
What customers say
The product received a 5-star rating in a single review. The reviewer used it for immunofluorescence and reported no unspecific staining, describing the outcome as great. Overall, the feedback highlights clean specificity and strong performance in IF applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Alessandro (Verified Customer) (11-06-2022) | no unspecific staining, great outcome
|
