• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated RPE65 Polyclonal antibody

RPE65 Polyclonal Antibody for IF-P
Cat No. CL488-17939

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

LCA2, mRPE65, rd12, Retinoid isomerohydrolase, Retinol isomerase, RP20, RPE65, sRPE65

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse eye tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-17939 targets RPE65 in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12356

Product name: Recombinant human RPE65 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 204-533 aa of BC075036

Sequence: YNIVKIPPLQADKEDPISKSEIVVQFPCSDRFKPSYVHSFGLTPNYIVFVETPVKINLFKFLSSWSLWGANYMDCFESNETMGVWLHIADKKRKKYLNNKYRTSPFNLFHHINTYEDNGFLIVDLCCWKGFEFVYNYLYLANLRENWEEVKKNARKAPQPEVRRYVLPLNIDKADTGKNLVTLPNTTATAILCSDETIWLEPEVLFSGPRQAFEFPQINYQKYCGKPYTYAYGLGLNHFVPDRLCKLNVKTKETWVWQEPDSYPSEPIFVSHPDALEEDDGVVLSVVVSPGAGQKPAYLLILNAKDLSEVARAEVEINIPVTFHGLFKKS

Predict reactive species
Full Name retinal pigment epithelium-specific protein 65kDa
Calculated Molecular Weight61 kDa
Observed Molecular Weight 65 kDa, 61 kDa
GenBank Accession NumberBC075036
Gene Symbol RPE65
Gene ID (NCBI) 6121
RRIDAB_3084013
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ16518
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

RPE65(Retinal pigment epithelium-specific 65 kDa protein) is also named as retinoid isomerohydrolase with the calculated molecular weight og 61 kDa and belongs to the carotenoid oxygenase family. It is a microsomal protein with isomerase activity in the retinoid visual cycle that playing a role in the isomerisation of all-trans (vitamin A) to 11-cis retinal, the chromophore of the visual pigments. It also might be involved in retinoid uptake of keratinocytes.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 RPE65 antibody CL488-17939Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...