RPE65 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83861-1-RR (same clone as 83861-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83861-1-RR (RPE65 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83861-1-PBS in a different storage buffer formulation.

RPE65 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83861-1-PBS

Clone No.240518F1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

240518F1, All-trans-retinyl-palmitate hydrolase, EC:3.1.1.64, EC:5.3.3.22, LCA2

---

Product Information

83861-1-PBS targets RPE65 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag12356

  Product name: Recombinant human RPE65 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 204-533 aa of BC075036

  Sequence: YNIVKIPPLQADKEDPISKSEIVVQFPCSDRFKPSYVHSFGLTPNYIVFVETPVKINLFKFLSSWSLWGANYMDCFESNETMGVWLHIADKKRKKYLNNKYRTSPFNLFHHINTYEDNGFLIVDLCCWKGFEFVYNYLYLANLRENWEEVKKNARKAPQPEVRRYVLPLNIDKADTGKNLVTLPNTTATAILCSDETIWLEPEVLFSGPRQAFEFPQINYQKYCGKPYTYAYGLGLNHFVPDRLCKLNVKTKETWVWQEPDSYPSEPIFVSHPDALEEDDGVVLSVVVSPGAGQKPAYLLILNAKDLSEVARAEVEINIPVTFHGLFKKS

• Full Name: retinal pigment epithelium-specific protein 65kDa
• Calculated Molecular Weight: 61 kDa
• Observed Molecular Weight: 65 kDa, 61 kDa
• GenBank Accession Number: BC075036
• Gene Symbol: RPE65
• Gene ID (NCBI): 6121
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q16518
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RPE65(Retinal pigment epithelium-specific 65 kDa protein) is also named as retinoid isomerohydrolase with the calculated molecular weight og 61 kDa and belongs to the carotenoid oxygenase family. It is a microsomal protein with isomerase activity in the retinoid visual cycle that playing a role in the isomerisation of all-trans (vitamin A) to 11-cis retinal, the chromophore of the visual pigments. It also might be involved in retinoid uptake of keratinocytes.