RPL13 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• RPL13 Recombinant monoclonal antibody (86205-2-RR)

• 

  WB analysis using 86205-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86205-2-RR (RPL13 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 86205-2-RR

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using RPL13 antibody (86205-2-RR, Clone: 250752D2 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity and Kinetic Characterization of 86205-2-RR

  Biolayer interferometry (BLl) kinetic assays of 86205-2-RR against Human RPL13 were performed. The affinity constant is 0.10 nM.

RPL13 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 86205-2-RR

Clone No.250752D2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, monkey

Applications

WB, IF/ICC, ELISA

Synonyms

60S ribosomal protein L13, BBC1, D16S444E, Large ribosomal subunit protein eL13, OK/SW-cl.46

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, K-562 cells, MCF-7 cells, COS-7 cells, SGC-7091 cells, NIH/3T3 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86205-2-RR targets RPL13 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, monkey samples.

• Tested Reactivity: human, mouse, monkey
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1814

  Product name: Recombinant human RPL13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-166 aa of BC014167

  Sequence: MAPSRNGMVLKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVRYHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPKKGDSSAEELKLATQLTGPVMPVRNVYKKEKA

• Full Name: ribosomal protein L13
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC014167
• Gene Symbol: RPL13
• Gene ID (NCBI): 6137
• RRID: AB_3744715
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P26373
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The mammalian ribosome comprises 79 ribosomal proteins and four rRNAs, which combine in equimolar ratios to form the small (40S) and large (60S) subunits. Ribosome proteins are a direct and critical target of the PI3K pathway in promoting growth.[PMID:15289434]. RPL13 may be a plausible candidate tumor suppressor gene, as knocking down L13 expression using small interfering RNA (siRNA) resulted in drastic attenuation of cancer cell growth with significant G1 and G2/M arrest of the cell cycle[PMID:16786168].