CoraLite® Plus 488-conjugated RPL13 Recombinant monoclonal antibody

RPL13 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-86205-2
Clone No.250752D2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, monkey

Applications

IF/ICC

60S ribosomal protein L13, BBC1, D16S444E, Large ribosomal subunit protein eL13, OK/SW-cl.46

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-86205-2 targets RPL13 in IF/ICC applications and shows reactivity with human, mouse, monkey samples.

Tested Reactivity human, mouse, monkey
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1814

Product name: Recombinant human RPL13 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-166 aa of BC014167

Sequence: MAPSRNGMVLKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVRYHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPKKGDSSAEELKLATQLTGPVMPVRNVYKKEKA

Predict reactive species
Full Name ribosomal protein L13
Calculated Molecular Weight 24 kDa
Observed Molecular Weight 24 kDa
GenBank Accession NumberBC014167
Gene Symbol RPL13
Gene ID (NCBI) 6137
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP26373
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The mammalian ribosome comprises 79 ribosomal proteins and four rRNAs, which combine in equimolar ratios to form the small (40S) and large (60S) subunits. Ribosome proteins are a direct and critical target of the PI3K pathway in promoting growth.[PMID:15289434]. RPL13 may be a plausible candidate tumor suppressor gene, as knocking down L13 expression using small interfering RNA (siRNA) resulted in drastic attenuation of cancer cell growth with significant G1 and G2/M arrest of the cell cycle[PMID:16786168].

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 RPL13 antibody CL488-86205-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...