CoraLite® Plus 488-conjugated RPL13 Recombinant monoclonal antibody

• 

  IF Staining of HepG2 using CL488-86205-2

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CoraLite® Plus 488 RPL13 antibody (CL488-86205-2, Clone: 250752D2 ) at dilution of 1:200.

RPL13 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-86205-2

Clone No.250752D2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, monkey

Applications

IF/ICC

Synonyms

60S ribosomal protein L13, BBC1, D16S444E, Large ribosomal subunit protein eL13, OK/SW-cl.46

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-86205-2 targets RPL13 in IF/ICC applications and shows reactivity with human, mouse, monkey samples.

• Tested Reactivity: human, mouse, monkey
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1814

  Product name: Recombinant human RPL13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-166 aa of BC014167

  Sequence: MAPSRNGMVLKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVRYHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPKKGDSSAEELKLATQLTGPVMPVRNVYKKEKA

• Full Name: ribosomal protein L13
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC014167
• Gene Symbol: RPL13
• Gene ID (NCBI): 6137
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P26373
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

The mammalian ribosome comprises 79 ribosomal proteins and four rRNAs, which combine in equimolar ratios to form the small (40S) and large (60S) subunits. Ribosome proteins are a direct and critical target of the PI3K pathway in promoting growth.[PMID:15289434]. RPL13 may be a plausible candidate tumor suppressor gene, as knocking down L13 expression using small interfering RNA (siRNA) resulted in drastic attenuation of cancer cell growth with significant G1 and G2/M arrest of the cell cycle[PMID:16786168].