RPL37A Polyclonal antibody

• 

  WB analysis using 14660-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14660-1-AP (RPL37A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of MCF-7 using 14660-1-AP

  IP result of anti-RPL37A (IP:14660-1-AP, 4ug; Detection:14660-1-AP 1:500) with MCF-7 cells lysate 3480 ug.

• 

  IHC staining of human breast cancer using 14660-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 14660-1-AP (RPL37A antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human breast cancer using 14660-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 14660-1-AP (RPL37A antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of SH-SY5Y using 14660-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed SH-SY5Y cells using 14660-1-AP (RPL37A antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• 

  FC experiment of MCF-7 using 14660-1-AP

  1X10^6 MCF-7 cells were intracellularly stained with 0.2 ug Anti-Human RPL37A (14660-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.2 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

RPL37A Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 14660-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

ribosomal protein L37a, Large ribosomal subunit protein eL43, 60S ribosomal protein L37a

---

Tested Applications

• Positive WB detected in: COLO 320 cells, HeLa cells, MCF-7 cells, SH-SY5Y cells
• Positive IP detected in: MCF-7 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SH-SY5Y cells
• Positive FC (Intra) detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• FC: See 1 publications below

Product Information

14660-1-AP targets RPL37A in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6330

  Product name: Recombinant human RPL37A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-72 aa of BC063476

  Sequence: MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSCMKTVAGGAWTYK

• Full Name: ribosomal protein L37a
• Calculated Molecular Weight: 10 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC063476
• Gene Symbol: RPL37A
• Gene ID (NCBI): 6168
• RRID: AB_2238668
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61513
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	FC	Transl Res; Ribosomal proteins as distinct "passengers" of microvesicles: new semantics in myeloma and mesenchymal stem cells' communication.; Authors - Mahmoud Dabbah
		J Cell Sci; Drp1 regulates transcription of ribosomal protein genes in embryonic hearts.; Authors - Qiancong Zhao
		Mol Psychiatry; Shank3 modulates Rpl3 expression and protein synthesis via mGlu5: implications for Phelan McDermid syndrome; Authors - Federica Giona
human	WB	iScience; TIAR and FMRP shape pro-survival nascent proteome of leukemia cells in the bone marrow microenvironment; Authors - Magdalena Wolczyk
human	WB	Cell; A non-canonical role for a small nucleolar RNA in ribosome biogenesis and senescence; Authors - Yujing Cheng