RPP25L Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RPP25L Polyclonal antibody, PBS Only (33447-1-PBS)

• 

  WB analysis using 33447-1-AP (same clone as 33447-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33447-1-AP (RPP25L antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33447-1-PBS in a different storage buffer formulation.

RPP25L Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33447-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

C9orf23, Ribonuclease P protein subunit p25-like protein, RNase P protein subunit-like p25, Rpp25-like protein

---

Product Information

33447-1-PBS targets RPP25L in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37795

  Product name: Recombinant human C9orf23 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-163 aa of BC032136

  Sequence: MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS

• Full Name: chromosome 9 open reading frame 23
• Observed Molecular Weight: 17-19 kDa
• GenBank Accession Number: BC032136
• Gene Symbol: C9orf23
• Gene ID (NCBI): 138716
• RRID: AB_3742973
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8N5L8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RPP25L (Ribonuclease P protein subunit p25-like protein), also known as C9orf23. RPP25L is a subunit of RNase P complex, which is mainly involved in the processing of tRNA precursor, and is responsible for cutting off the 5' leading sequence of tRNA precursor to generate mature tRNA. In addition, RPP25L may also participate in other RNA metabolism processes, such as the processing of rRNA.