RPP38 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RPP38 Polyclonal antibody, PBS Only (12874-1-PBS)

• 

  WB analysis of rat kidney using 12874-1-AP (same clone as 12874-1-PBS)

  rat kidney tissue were subjected to SDS PAGE followed by western blot with 12874-1-AP (RPP38 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12874-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 12874-1-AP (same clone as 12874-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 12874-1-AP (RPP38 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12874-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat liver using 12874-1-AP (same clone as 12874-1-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 12874-1-AP (RPP38 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12874-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 12874-1-AP (same clone as 12874-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 12874-1-AP (RPP38 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12874-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human kidney using 12874-1-AP (same clone as 12874-1-PBS)

  human kidney tissue were subjected to SDS PAGE followed by western blot with 12874-1-AP (RPP38 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12874-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 12874-1-AP (same clone as 12874-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using RPP38 antibody (12874-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 12874-1-PBS in a different storage buffer formulation.

RPP38 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 12874-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

RNaseP protein p38, RP11 455B2.5

---

Product Information

12874-1-PBS targets RPP38 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3552

  Product name: Recombinant human RPP38 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-283 aa of BC029494

  Sequence: MAAAPQAPGRGSLRKTRPLVVKTSLNNPYIIRWSALESEDMHFILQTLEDRLKAIGLQKIEDKKKKNKTPFLKKESREKCSIAVDISENLKEKKTDAKQQVSGWTPAHVRKQLAIGVNEVTRALERRELLLVLVCKSVKPAMITSHLIQLSLSRSVPACQVPRLSERIAPVIGLKCVLALAFKKNTTDFVDEVRAIIPRVPSLSVPWLQDRIEDSGENLETEPLESQDRELLDTSFEDLSKPKRKLADGRQASVTLQPLKIKKLIPNPNKIRKPPKSKKATPK

• Full Name: ribonuclease P/MRP 38kDa subunit
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC029494
• Gene Symbol: RPP38
• Gene ID (NCBI): 10557
• RRID: AB_2285405
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P78345
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.