RPS27A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RPS27A Polyclonal antibody, PBS Only (14946-1-PBS)

• 

  WB analysis of mouse cerebellum using 14946-1-AP (same clone as 14946-1-PBS)

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 14946-1-AP (RPS27A antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14946-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 14946-1-AP (same clone as 14946-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 14946-1-AP (RPS27A antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14946-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human endometrial cancer using 14946-1-AP (same clone as 14946-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 14946-1-AP (RPS27A Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14946-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cerebellum using 14946-1-AP (same clone as 14946-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 14946-1-AP (RPS27A Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14946-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human endometrial cancer using 14946-1-AP (same clone as 14946-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 14946-1-AP (RPS27A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14946-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human endometrial cancer using 14946-1-AP (same clone as 14946-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 14946-1-AP (RPS27A Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14946-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cerebellum using 14946-1-AP (same clone as 14946-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 14946-1-AP (RPS27A Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14946-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 14946-1-AP (same clone as 14946-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using RPS27A antibody (14946-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 14946-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 14946-1-AP (same clone as 14946-1-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human RPS27A (14946-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 14946-1-PBS in a different storage buffer formulation.

RPS27A Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 14946-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

CEP80, HUBCEP80, ribosomal protein S27a, Small ribosomal subunit protein eS31, UBA80

---

Product Information

14946-1-PBS targets RPS27A in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6750

  Product name: Recombinant human RPS27A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-156 aa of BC001392

  Sequence: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK

• Full Name: ribosomal protein S27a
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 9 kDa, 18 kDa
• GenBank Accession Number: BC001392
• Gene Symbol: RPS27A
• Gene ID (NCBI): 6233
• RRID: AB_2878093
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P62979
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RPS27A, also named as UBA80 and UBCEP1, can be cleaved into two chains Ubiquitin and 40S ribosomal protein S27a. Ubiquitin is a highly conserved 76-amino acid protein that plays a key role in protein degradation. Ubiquitin is synthesized as precursor proteins that consist either of polyubiquitin chains that are cleaved into moieties of the UBB or UBC types, or single ubiquitin moieties fused 5-prime to unrelated carboxyl extension proteins (UBA type) such as UBA52 and UBA80 (RPS27A) [PMID:10772958]