CoraLite® Plus 488-conjugated RRM1 Recombinant monoclonal antibody

• 

  IF Staining of HepG2 using CL488-86135

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CoraLite® Plus 488 RRM1 antibody (CL488-86135, Clone: 250707E6 ) at dilution of 1:200, CL594-Phalloidin (red).

RRM1 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-86135

Clone No.250707E6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

EC:1.17.4.1, Ribonucleoside-diphosphate reductase large subunit, Ribonucleoside-diphosphate reductase subunit M1, ribonucleotide reductase M1, RIR1

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-86135 targets RRM1 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0789

  Product name: Recombinant human RRM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 593-792 aa of BC006498

  Sequence: IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS

• Full Name: ribonucleotide reductase M1
• Calculated Molecular Weight: 90 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC006498
• Gene Symbol: RRM1
• Gene ID (NCBI): 6240
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P23921
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Ribonucleoside-diphosphate reductase functions as a heterodimer of a large and a small subunits in deoxyribonucleotide synthesis. RRM1 constitutes to the large subunit (R1) of ribonucleotide reductase, and it can either form heterodimer with small subunit RRM or RRM2B(PMID:16376858). RRM1 provides the precursors necessary for DNA synthesis. RRM1 can not be detected in quiescent cells, while its mRNA and protein are present throughout the cell cycle in cycling cells(PMID:8188248). Researches showed that RRM1 is involved in carcinogenesis, tumor progression, and the resistance of non-small-cell lung cancer (NSCLC) to treatment. Low level expression of RRM1 in NSCLC is associated with poor survival (PMID:17314339).