RRP12 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RRP12 Polyclonal antibody, PBS Only (26849-1-PBS)

• 

  WB analysis using 26849-1-AP (same clone as 26849-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26849-1-AP (RRP12 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26849-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 26849-1-AP (same clone as 26849-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using RRP12 antibody (26849-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 26849-1-PBS in a different storage buffer formulation.

RRP12 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 26849-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

26849-1-PBS targets RRP12 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25271

  Product name: Recombinant human RRP12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-151 aa of BC012745

  Sequence: MGRSGKLPSGVSAKLKRWKKGHSSDSNPAICRHRQAARSRFFSRPSGRSDLTVDAVKLHNELQSGSLRLGKSEAPETPMEEEAELVLTEKSSGTFLSGLSDCTNVTFSKVQRFWESNSAAHKEICAVLAAVTEVIRSQGGKETETEYFAAL

• Full Name: ribosomal RNA processing 12 homolog (S. cerevisiae)
• Calculated Molecular Weight: 1297 aa, 144 kDa
• Observed Molecular Weight: 144-150 kDa
• GenBank Accession Number: BC012745
• Gene Symbol: RRP12
• Gene ID (NCBI): 23223
• RRID: AB_3669571
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5JTH9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.