RSBN1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RSBN1 Polyclonal antibody, PBS Only (24734-1-PBS)

• 

  WB analysis using 24734-1-AP (same clone as 24734-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24734-1-AP (RSBN1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24734-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 24734-1-AP (same clone as 24734-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using RSBN1 antibody (24734-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 24734-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 24734-1-AP (same clone as 24734-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using RSBN1 antibody (24734-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 24734-1-PBS in a different storage buffer formulation.

RSBN1 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 24734-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

ROSBIN, Rsbn, RSBN 1, Rsbp

---

Product Information

24734-1-PBS targets RSBN1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20895

  Product name: Recombinant human RSBN1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-411 aa of BC026155

  Sequence: MAAQVGAVRVVRAVAAQEEPDKEGKEKPHAGVSPRGVKRQRRSSSGGSQEKRGRPSQEPPLAPPHRRRRSRQHPGPLPPTNAAPTVPGPVEPLLLPPPPPPSLAPAGPAVAAPLPAPSTSALFTFSPLTVSAAGPKHKGHKERHKHHHHRGPDGDPSSCGTDLKHKDKQENGERTGGVPLIKAPKRETPDENGKTQRADDFVLKKIKKKKKKKHREDMRGRRLKMYNKEVQTVCAGLTRISKEILTQGQINSTSGLNKESFRYLKDEQLCRLNLGMQEYRVPQGVQTPFMTHQEHSIRRNFLKTGTKFSNFIHEEHQSNGGALVLHAYMDELSFLSPMEMERFSEEFLALTFSENEKNAAYYALAIVHGAAAYLPDFLDYFAFNFPNTPVKMEILGKKDIETTTISNFHTQ

• Full Name: round spermatid basic protein 1
• Calculated Molecular Weight: 411 aa, 46 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC026155
• Gene Symbol: RSBN1
• Gene ID (NCBI): 54665
• RRID: AB_3742124
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5VWQ0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RSBN1 is expressed not only in the testes, but also in the brain and ovaries. RSBN1 could play a role in both meiotic and post-meiotic progression, suggesting that it may also be involved in oogenesis. On the other hand, RSBN1 may be involved in brain development and function, as well as the regulation of neuronal cells, since another H4K20 demethylase, PHF8, regulates neuronal cell survival and brain development, while LSD1 regulates memory formation (PMID: 20622853, 26214369, 34185806).