Product Information
23762-1-PBS targets RSK2 in WB, IHC, IF/ICC, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20620 Product name: Recombinant human RPS6KA3 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 666-740 aa of BC096301 Sequence: QRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVKGAMAATYSALNRNQSPVLEPVGRSTLAQRRGIKKITSTAL Predict reactive species |
| Full Name | ribosomal protein S6 kinase, 90kDa, polypeptide 3 |
| Calculated Molecular Weight | 740 aa, 84 kDa |
| Observed Molecular Weight | 84 kDa |
| GenBank Accession Number | BC096301 |
| Gene Symbol | RSK2 |
| Gene ID (NCBI) | 6197 |
| RRID | AB_2879318 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P51812 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
RPS6KA3(Ribosomal protein S6 kinase alpha-3) is also named as ISPK1, MAPKAPK1B, RSK2 and belongs to the protein kinase superfamily. It localizes at the kinetochores under spindle checkpoint conditions, and during mitosis, associated with the centrosomes, the spindle and at the mid-body(PMID:20383198). It is required for EGF activated phosphorylation of histone H3, which may cause chromatin remodeling and facilitate gene transcription and maybe playing an essential regulatory role in protein synthesis during cell proliferation.





































