Home
Products
Primary Antibodies
RSK2 Polyclonal antibody, PBS Only (23762-1-PBS)

Filter: AllWBIPIHCIF-PIF/ICC

WB analysis of K-562 using 23762-1-AP (same clone as 23762-1-PBS)
WB result of RSK2 antibody (23762-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-RSK2 transfected K-562 cells. This data was developed using the same antibody clone with 23762-1-PBS in a different storage buffer formulation.
WB analysis using 23762-1-AP (same clone as 23762-1-PBS)
NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 23762-1-AP (RSK2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23762-1-PBS in a different storage buffer formulation.
WB analysis of MCF-7 using 23762-1-AP (same clone as 23762-1-PBS)
MCF7 cells were subjected to SDS PAGE followed by western blot with 23762-1-AP (RSK2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23762-1-PBS in a different storage buffer formulation.
WB analysis of NIH/3T3 using 23762-1-AP (same clone as 23762-1-PBS)
NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 23762-1-AP (RSK2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23762-1-PBS in a different storage buffer formulation.
WB analysis of HepG2 using 23762-1-AP (same clone as 23762-1-PBS)
HepG2 cells were subjected to SDS PAGE followed by western blot with 23762-1-AP (RSK2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23762-1-PBS in a different storage buffer formulation.
WB analysis of K-562 using 23762-1-AP (same clone as 23762-1-PBS)
K-562 cells were subjected to SDS PAGE followed by western blot with 23762-1-AP (RSK2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23762-1-PBS in a different storage buffer formulation.
IP experiment of K-562 using 23762-1-AP (same clone as 23762-1-PBS)
IP result of anti-RSK2 (IP:23762-1-AP, 4ug; Detection:23762-1-AP 1:4000) with K-562 cells lysate 3680 ug. This data was developed using the same antibody clone with 23762-1-PBS in a different storage buffer formulation.
IP experiment of K-562 using 23762-1-AP (same clone as 23762-1-PBS)
IP result of anti-RSK2 (IP:23762-1-AP, 4ug; Detection:23762-1-AP 1:1000) with K-562 cells lysate 4000 ug. This data was developed using the same antibody clone with 23762-1-PBS in a different storage buffer formulation.
IP experiment of K-562 using 23762-1-AP (same clone as 23762-1-PBS)
IP result of anti-RSK2 (IP:23762-1-AP, 4ug; Detection:23762-1-AP 1:1000) with K-562 cells lysate 4000ug. This data was developed using the same antibody clone with 23762-1-PBS in a different storage buffer formulation.
IP experiment of K-562 using 23762-1-AP (same clone as 23762-1-PBS)
IP result of anti-RSK2 (IP:23762-1-AP, 4ug; Detection:23762-1-AP 1:1000) with K-562 cells lysate 4000 ug. This data was developed using the same antibody clone with 23762-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 23762-1-AP (same clone as 23762-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 23762-1-AP (RSK2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23762-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 23762-1-AP (same clone as 23762-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 23762-1-AP (RSK2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23762-1-PBS in a different storage buffer formulation.
IHC staining of mouse colon using 23762-1-AP (same clone as 23762-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 23762-1-AP (RSK2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23762-1-PBS in a different storage buffer formulation.
IHC staining of mouse kidney using 23762-1-AP (same clone as 23762-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 23762-1-AP (RSK2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23762-1-PBS in a different storage buffer formulation.
IF Staining of mouse skeletal muscle using 23762-1-AP (same clone as 23762-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse skeletal muscle tissue using RSK2 antibody (23762-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23762-1-PBS in a different storage buffer formulation.
IF Staining of mouse brain using 23762-1-AP (same clone as 23762-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using 23762-1-AP (RSK2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 23762-1-PBS in a different storage buffer formulation.
IF Staining of mouse brain using 23762-1-AP (same clone as 23762-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using 23762-1-AP (RSK2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 23762-1-PBS in a different storage buffer formulation.
IF Staining of HepG2 using 23762-1-AP (same clone as 23762-1-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using 23762-1-AP (RSK2 antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 23762-1-PBS in a different storage buffer formulation.
IF Staining of HUVEC using 23762-1-AP (same clone as 23762-1-PBS)
Immunofluorescent analysis of HUVEC cells using 23762-1-AP (RSK2 antibody) at dilution of 1:25 and Rhodamine-Goat anti-Rabbit IgG. This data was developed using the same antibody clone with 23762-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

RSK2 Polyclonal antibody, PBS Only

Name: RSK2 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 23762-1-PBS

RSK2 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, Indirect ELISA

Cat No. 23762-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IF-P, IP, Indirect ELISA

Synonyms

RPS6KA3, CLS, EC:2.7.11.1, HU 3, Insulin-stimulated protein kinase 1

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

23762-1-PBS targets RSK2 in WB, IHC, IF/ICC, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag20620 Product name: Recombinant human RPS6KA3 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 666-740 aa of BC096301 Sequence: QRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVKGAMAATYSALNRNQSPVLEPVGRSTLAQRRGIKKITSTAL Predict reactive species
Full Name	ribosomal protein S6 kinase, 90kDa, polypeptide 3
Calculated Molecular Weight	740 aa, 84 kDa
Observed Molecular Weight	84 kDa
GenBank Accession Number	BC096301
Gene Symbol	RSK2
Gene ID (NCBI)	6197
RRID	AB_2879318
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P51812
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

RPS6KA3(Ribosomal protein S6 kinase alpha-3) is also named as ISPK1, MAPKAPK1B, RSK2 and belongs to the protein kinase superfamily. It localizes at the kinetochores under spindle checkpoint conditions, and during mitosis, associated with the centrosomes, the spindle and at the mid-body(PMID:20383198). It is required for EGF activated phosphorylation of histone H3, which may cause chromatin remodeling and facilitate gene transcription and maybe playing an essential regulatory role in protein synthesis during cell proliferation.