RSPH9 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85026-4-RR (same clone as 85026-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85026-4-RR (RSPH9 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85026-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 85026-4-RR (same clone as 85026-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 85026-4-RR (RSPH9 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85026-4-PBS in a different storage buffer formulation.

• 

  IHC staining of rat testis using 85026-4-RR (same clone as 85026-4-PBS)

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 85026-4-RR (RSPH9 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85026-4-PBS in a different storage buffer formulation.

RSPH9 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 85026-4-PBS

Clone No.242584D5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

242584D5, C6orf206, CILD12, MRPS18AL1

---

Product Information

85026-4-PBS targets RSPH9 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag19745

  Product name: Recombinant human RSPH9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-276 aa of BC029519

  Sequence: MDADSLLLSLELASGSGQGLSPDRRASLLTSLMLVKRDYRYDRVLFWGRILGLVADYYIAQGLSEDQLAPRKTLYSLNCTEWSLLPPATEEMVAQSSVVKGRFMGDPSYEYEHTELQKVNEGEKVFEEEIVVQIKEETRLVSVIDQIDKAVAIIPRGALFKTPFGPTHVNRTFEGLSLSEAKKLSSYFHFREPVELKNKTLLEKADLDPSLDFMDSLEHDIPKGSWSIQMERGNALVVLRSLLWPGLTFYHAPRTKNYGYVYVGTGEKNMDLPFML

• Full Name: radial spoke head 9 homolog (Chlamydomonas)
• Calculated Molecular Weight: 276 aa, 31 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC029519
• Gene Symbol: RSPH9
• Gene ID (NCBI): 221421
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H1X1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RSPH9 (Radial Spoke Head 9 Homolog) is a protein involved in the structure and function of cilia and flagella. Cilia and flagella are hair-like structures that extend from the surface of many eukaryotic cells and play critical roles in cell motility, sensory perception, and signaling. The RSPH9 protein is a component of the radial spoke, a structure within the axoneme (the core of cilia and flagella) that is essential for the regulation of ciliary and flagellar movement.