RSPH9 Recombinant monoclonal antibody

RSPH9 Uni-rAb® Recombinant Antibody for WB, IHC, ELISA
Cat No. 85026-4-RR
Clone No.242584D5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

242584D5, C6orf206, CILD12, MRPS18AL1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse testis tissue, rat testis tissue, human testis cells
Positive IHC detected inrat testis tissue, mouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85026-4-RR targets RSPH9 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag19745

Product name: Recombinant human RSPH9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-276 aa of BC029519

Sequence: MDADSLLLSLELASGSGQGLSPDRRASLLTSLMLVKRDYRYDRVLFWGRILGLVADYYIAQGLSEDQLAPRKTLYSLNCTEWSLLPPATEEMVAQSSVVKGRFMGDPSYEYEHTELQKVNEGEKVFEEEIVVQIKEETRLVSVIDQIDKAVAIIPRGALFKTPFGPTHVNRTFEGLSLSEAKKLSSYFHFREPVELKNKTLLEKADLDPSLDFMDSLEHDIPKGSWSIQMERGNALVVLRSLLWPGLTFYHAPRTKNYGYVYVGTGEKNMDLPFML

Predict reactive species
Full Name radial spoke head 9 homolog (Chlamydomonas)
Calculated Molecular Weight 276 aa, 31 kDa
Observed Molecular Weight33 kDa
GenBank Accession NumberBC029519
Gene Symbol RSPH9
Gene ID (NCBI) 221421
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9H1X1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RSPH9 (Radial Spoke Head 9 Homolog) is a protein involved in the structure and function of cilia and flagella. Cilia and flagella are hair-like structures that extend from the surface of many eukaryotic cells and play critical roles in cell motility, sensory perception, and signaling. The RSPH9 protein is a component of the radial spoke, a structure within the axoneme (the core of cilia and flagella) that is essential for the regulation of ciliary and flagellar movement.

Protocols

Product Specific Protocols
IHC protocol for RSPH9 antibody 85026-4-RRDownload protocol
WB protocol for RSPH9 antibody 85026-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...