RTF1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RTF1 Polyclonal antibody, PBS Only (12170-1-PBS)

• 

  WB analysis using 12170-1-AP (same clone as 12170-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12170-1-AP (RTF1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12170-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HL-60 using 12170-1-AP (same clone as 12170-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 12170-1-AP (RTF1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12170-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 12170-1-AP (same clone as 12170-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 12170-1-AP (RTF1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12170-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 12170-1-AP (same clone as 12170-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12170-1-AP (RTF1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12170-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 12170-1-AP (same clone as 12170-1-PBS)

  IP result of anti-RTF1 (IP:12170-1-AP, 4ug; Detection:12170-1-AP 1:500) with HeLa cells lysate 2400ug. This data was developed using the same antibody clone with 12170-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 12170-1-AP (same clone as 12170-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 12170-1-AP (RTF1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12170-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 12170-1-AP (same clone as 12170-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 12170-1-AP (RTF1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12170-1-PBS in a different storage buffer formulation.

RTF1 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 12170-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

CDG1N, GTL7, KIAA0252, RNA polymerase-associated protein RTF1 homolog

---

Product Information

12170-1-PBS targets RTF1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2812

  Product name: Recombinant human RTF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-307 aa of BC015052

  Sequence: MKKQANKTASSGSSDKDSSAESSAPEEGEVSDSDSNSSSSSSDSDSSSEDEEFHDGYGEDLMGDEEDRARLEQMTEKEREQELFNRIEKREVLKRRFEIKKKLKTAKKKEKKEKKKKQEEEQEKKKLTQIQESQVTSHNKERRSKRDEKLDKKSQAMEELKAEREKRKNRTAELLAKKQPLKTSEVYSDDEEEEEDDKSSEKSDRSSRTSSSDEEEEKEEIPPKSQPVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVYRVAEITGVVETAKVYQLGGTRTNKGLQLRHGN

• Full Name: Rtf1, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae)
• Calculated Molecular Weight: 585aa,67 kDa; 710aa,80 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC015052
• Gene Symbol: RTF1
• Gene ID (NCBI): 23168
• RRID: AB_2180931
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92541
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RTF1 (RNA polymerase-associated protein RTF1 homolog) is a multifunctional component of the Paf1 complex that regulates gene expression by directing cotranscriptional histone modification (PMID: 17576814). RTF1 is essential for global methylation of H3-Lys4 and H3-Lys79, but not H3-Lys36 (PMID: 12876293).