RanBP2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RanBP2 Polyclonal antibody, PBS Only (27606-1-PBS)

• 

  WB analysis using 27606-1-AP (same clone as 27606-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27606-1-AP (RanBP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27606-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat liver using 27606-1-AP (same clone as 27606-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 27606-1-AP (RanBP2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27606-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 27606-1-AP (same clone as 27606-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 27606-1-AP (RanBP2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27606-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RanBP2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27606-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

358 kDa nucleoporin, ANE1, E3 SUMO protein ligase RanBP2, Nucleoporin Nup358, NUP358

---

Product Information

27606-1-PBS targets RanBP2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26370

  Product name: Recombinant human RANBP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2801-2900 aa of NM_006267

  Sequence: MKSISSPSVSSETMDKPVDLSTRKEIDTDSTSQGESKIVSFGFGSSTGLSFADLASSNSGDFAFGSKDKNFQWANTGAAVFGTQSVGTQSAGKVGEDEDGS

• Full Name: RAN binding protein 2
• Calculated Molecular Weight: 358 kDa
• Observed Molecular Weight: 358 kDa
• GenBank Accession Number: NM_006267
• Gene Symbol: RANBP2
• Gene ID (NCBI): 5903
• RRID: AB_2880923
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49792
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RanBP2 (Ran-binding protein 2) is also named as p270 and NUP358, and belongs to the RanBP2 E3 ligase family. RanBP2 is E3 SUMO-protein ligase which facilitates SUMO1 and SUMO2 conjugation by UBE2I (PMID:11792325, PMID:22194619). RanBP2 involved in transport factor (Ran-GTP, karyopherin)-mediated protein import via the F-G repeat-containing domain which acts as a docking site for substrates (PMID:7775481). It is component of the nuclear export pathway (PMID:10078529). RanBP2 recruits BICD2 to the nuclear envelope and cytoplasmic stacks of nuclear pore complex known as annulate lamellae during G2 phase of cell cycle (PMID:20386726).