S100B Recombinant monoclonal antibody

S100B Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, FC (Intra), ELISA
Cat No. 82271-8-RR
Clone No.1E2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, FC (Intra), ELISA

S100 beta, 1E2, Protein S100 B, Protein S100-B, S100 calcium-binding protein B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inC6 cells, A375 cells, rat brain tissue
Positive IHC detected inHuman appendicitis tissue, rat brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inrat brain tissue, mouse brain tissue
Positive FC (Intra) detected inA375 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10300
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82271-8-RR targets S100B in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7440

Product name: Recombinant human S100B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-92 aa of BC001766

Sequence: MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Predict reactive species
Full Name S100 calcium binding protein B
Calculated Molecular Weight 11 kDa
Observed Molecular Weight11 kDa
GenBank Accession NumberBC001766
Gene Symbol S100 Beta
Gene ID (NCBI) 6285
RRIDAB_3670520
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04271
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

S100B is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs and has been implicated in the regulation of cellular activities such as metabolism, motility and proliferation. In the nervous system, S100B is constitutively released by astrocytes into the extracellular space and at nanomolar concentrations, it can promote neurite outgrowth and protect neurons against oxidative stress. Within the central nervous system (CNS), S100B is thought to be a marker for astroglial activation, linking astrocyte dysfunction to schizophrenia. In addition to astrocytes, S100B is released from many cell types, such as, adipocytes, chondrocytes, cardiomyocytes and lymphocytes. Serum S100B represents a new biomarker for mood disorders.

Protocols

Product Specific Protocols
FC protocol for S100B antibody 82271-8-RRDownload protocol
IF protocol for S100B antibody 82271-8-RRDownload protocol
IHC protocol for S100B antibody 82271-8-RRDownload protocol
WB protocol for S100B antibody 82271-8-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...