Tested Applications
| Positive WB detected in | C6 cells, A375 cells, rat brain tissue |
| Positive IHC detected in | Human appendicitis tissue, rat brain tissue, human tonsillitis tissue, human malignant melanoma tissue, human gliomas tissue, human small intestine tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat brain tissue, mouse brain tissue |
| Positive IF-Fro detected in | mouse brain tissue |
| Positive FC (Intra) detected in | A375 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10300 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
82271-8-RR targets S100B in WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag7440 Product name: Recombinant human S100B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-92 aa of BC001766 Sequence: MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE Predict reactive species |
| Full Name | S100 calcium binding protein B |
| Calculated Molecular Weight | 11 kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | BC001766 |
| Gene Symbol | S100 Beta |
| Gene ID (NCBI) | 6285 |
| RRID | AB_3670520 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P04271 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
S100B is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs and has been implicated in the regulation of cellular activities such as metabolism, motility and proliferation. In the nervous system, S100B is constitutively released by astrocytes into the extracellular space and at nanomolar concentrations, it can promote neurite outgrowth and protect neurons against oxidative stress. Within the central nervous system (CNS), S100B is thought to be a marker for astroglial activation, linking astrocyte dysfunction to schizophrenia. In addition to astrocytes, S100B is released from many cell types, such as, adipocytes, chondrocytes, cardiomyocytes and lymphocytes. Serum S100B represents a new biomarker for mood disorders.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for S100B antibody 82271-8-RR | Download protocol |
| IF protocol for S100B antibody 82271-8-RR | Download protocol |
| IHC protocol for S100B antibody 82271-8-RR | Download protocol |
| WB protocol for S100B antibody 82271-8-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
What customers say
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Viera (Verified Customer) (01-28-2026) | Immunofluorescence (IF) staining was performed on frozen rat hippocampal sections using anti-S100B antibody (rabbit polyclonal, Proteintech, 82271-8-RR). Tissue sections were fixed with 4% paraformaldehyde, permeabilized with 0.3% Triton X-100, and blocked with 10% normal donkey serum (NDS) in PBS for 1 h at room temperature. Sections were incubated overnight (18 h) at 4 °C with primary antibodies against S100B (1:1000) and NeuN (mouse monoclonal, Merck, MAB377; 1:1000). After washing, sections were incubated with Alexa Fluor® 594 AffiniPure® donkey anti-rabbit IgG (H+L) (Jackson ImmunoResearch, 711-585-152; 1:500) and Alexa Fluor® 488 AffiniPure® donkey anti-mouse IgG (H+L) (Jackson ImmunoResearch, 715-545-150; 1:500).
![]() |




























































