Use Able AI chat for product recommendations

CoraLite® Plus 488-conjugated S100B Recombinant monoclonal antibody

S100B Uni-rAb® Recombinant Antibody for IF-P

Cat No. CL488-82271-8
Clone No.1E2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

S100 beta, 1E2, Protein S100 B, Protein S100-B, S100 calcium-binding protein B

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82271-8 targets S100B in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7440

Product name: Recombinant human S100B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-92 aa of BC001766

Sequence: MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Predict reactive species
Full Name S100 calcium binding protein B
Calculated Molecular Weight 11 kDa
Observed Molecular Weight11 kDa
GenBank Accession NumberBC001766
Gene Symbol S100 Beta
Gene ID (NCBI) 6285
RRIDAB_3747316
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04271
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

S100B is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs and has been implicated in the regulation of cellular activities such as metabolism, motility and proliferation. In the nervous system, S100B is constitutively released by astrocytes into the extracellular space and at nanomolar concentrations, it can promote neurite outgrowth and protect neurons against oxidative stress. Within the central nervous system (CNS), S100B is thought to be a marker for astroglial activation, linking astrocyte dysfunction to schizophrenia. In addition to astrocytes, S100B is released from many cell types, such as, adipocytes, chondrocytes, cardiomyocytes and lymphocytes. Serum S100B represents a new biomarker for mood disorders.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 S100B antibody CL488-82271-8Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...