Home
Products
Primary Antibodies
S100A1 Polyclonal antibody, PBS Only (16027-1-PBS)

Filter: AllWBIHCIF-P

WB analysis of human heart using 16027-1-AP (same clone as 16027-1-PBS)
human heart tissue were subjected to SDS PAGE followed by western blot with 16027-1-AP (S100A1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16027-1-PBS in a different storage buffer formulation.
WB analysis of human heart using 16027-1-AP (same clone as 16027-1-PBS)
human heart tissue were subjected to SDS PAGE followed by western blot with 16027-1-AP (S100A1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16027-1-PBS in a different storage buffer formulation.
IHC staining of human malignant melanoma using 16027-1-AP (same clone as 16027-1-PBS)
Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:200 (under 10x lens).. This data was developed using the same antibody clone with 16027-1-PBS in a different storage buffer formulation.
IHC staining of human malignant melanoma using 16027-1-AP (same clone as 16027-1-PBS)
Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:200 (under 40x lens).. This data was developed using the same antibody clone with 16027-1-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 16027-1-AP (same clone as 16027-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16027-1-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 16027-1-AP (same clone as 16027-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16027-1-PBS in a different storage buffer formulation.
IHC staining of rat brain using 16027-1-AP (same clone as 16027-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16027-1-PBS in a different storage buffer formulation.
IHC staining of rat brain using 16027-1-AP (same clone as 16027-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16027-1-PBS in a different storage buffer formulation.
IHC staining of human thyroid cancer using 16027-1-AP (same clone as 16027-1-PBS)
Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16027-1-PBS in a different storage buffer formulation.
IHC staining of human thyroid cancer using 16027-1-AP (same clone as 16027-1-PBS)
Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16027-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 16027-1-AP (same clone as 16027-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16027-1-AP (S100A1 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 16027-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 16027-1-AP (same clone as 16027-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16027-1-AP (S100A1 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 16027-1-PBS in a different storage buffer formulation.
IHC staining of human appendicitis using 16027-1-AP (same clone as 16027-1-PBS)
Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16027-1-PBS in a different storage buffer formulation.
IHC staining of human appendicitis using 16027-1-AP (same clone as 16027-1-PBS)
Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16027-1-PBS in a different storage buffer formulation.
IHC staining of human appendicitis using 16027-1-AP (same clone as 16027-1-PBS)
Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16027-1-PBS in a different storage buffer formulation.
IHC staining of human appendicitis using 16027-1-AP (same clone as 16027-1-PBS)
Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16027-1-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 16027-1-AP (same clone as 16027-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16027-1-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 16027-1-AP (same clone as 16027-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16027-1-PBS in a different storage buffer formulation.
IHC staining of human ovary tumor using 16027-1-AP (same clone as 16027-1-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16027-1-PBS in a different storage buffer formulation.
IHC staining of human ovary tumor using 16027-1-AP (same clone as 16027-1-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16027-1-PBS in a different storage buffer formulation.
IF Staining of human ovary cancer using 16027-1-AP (same clone as 16027-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed human ovary cancer cells using 16027-1-AP (S100A1 antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 16027-1-PBS in a different storage buffer formulation.
IF Staining of human ovary cancer using 16027-1-AP (same clone as 16027-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed human ovary cancer cells using 16027-1-AP (S100A1 antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 16027-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

S100A1 Polyclonal antibody, PBS Only

Name: S100A1 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 16027-1-PBS

S100A1 Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 16027-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

Protein S100 A1, Protein S100-A1, S 100 protein alpha chain, S 100 protein subunit alpha, S100 calcium-binding protein A1

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

16027-1-PBS targets S100A1 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag8871 Product name: Recombinant human S100A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-94 aa of BC014392 Sequence: MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS Predict reactive species
Full Name	S100 calcium binding protein A1
Calculated Molecular Weight	94 aa, 11 kDa
Observed Molecular Weight	10 kDa
GenBank Accession Number	BC014392
Gene Symbol	S100A1
Gene ID (NCBI)	6271
RRID	AB_2183214
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P23297
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

S100A1 belongs to the S100 protein family, which represents the largest group among EF-hand Ca2+-binding proteins exclusively expressed in vertebrates. S100 proteins have been described as central regulators of numerous cellular and molecular processes, often operating in a cell-type-specific manner (PMID: 11991838). S100A1 is a central regulator of Ca2+-driven networks that orchestrates compartmentalized Ca2+ fluxes in the heart (PMID: 22336719, PMID: 26021637). S100A1 is primarily expressed in cardiomyocytes (CM). Endothelial cells (EC) express significantly lower S100A1 levels, whereas fibroblasts do not express S100A1 (PMID: 38641766).