Tested Applications
| Positive WB detected in | A-204 cells, MCF-7 cells, SKOV-3 cells |
| Positive IHC detected in | human thyroid cancer tissue, human brain tissue, human heart tissue, human kidney tissue, human lung tissue, human ovary tissue, human placenta tissue, human skin tissue, human spleen tissue, human testis tissue, human thyroid tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14987-1-AP targets S100A13 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6971 Product name: Recombinant human S100A13 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC000632 Sequence: MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK Predict reactive species |
| Full Name | S100 calcium binding protein A13 |
| Calculated Molecular Weight | 11 kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | BC000632 |
| Gene Symbol | S100A13 |
| Gene ID (NCBI) | 6284 |
| RRID | AB_2878097 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99584 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for S100A13 antibody 14987-1-AP | Download protocol |
| IHC protocol for S100A13 antibody 14987-1-AP | Download protocol |
| WB protocol for S100A13 antibody 14987-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The S100A13 Polyclonal antibody (Cat# 14987-1-AP) has 3 citations. They appear in Gastroenterology (2023), Frontiers in Immunology (2023), and Journal of Oral Pathology and Medicine (2021). The research fields span gastrointestinal stromal tumor proteomics, uveal melanoma immune-related gene signatures, and oral squamous cell carcinoma cisplatin sensitivity, all involving human samples with WB and/or IHC applications.
| Species | Application | Title |
|---|---|---|
Gastroenterology Proteomic characterization identifies clinically relevant subgroups of gastrointestinal stromal tumors | ||
Front Immunol Identification of a novel immune-related gene signature for prognosis and the tumor microenvironment in patients with uveal melanoma combining single-cell and bulk sequencing data
| ||
J Oral Pathol Med Systematic screening identifies a TEAD4-S100A13 axis modulating cisplatin sensitivity of oral squamous cell carcinoma cells.
|
Reviews
What customers say
The single review for this product was submitted for a Western Blot application using ARPE-19 cells at a 1:500 dilution. The reviewer rated it 1 star, reporting that no bands were observed. However, they noted that this result may not reflect the antibody's performance in other sample types. Overall, the feedback is limited and negative for this specific use case, though the reviewer acknowledged the result might not generalize to other applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Guorong (Verified Customer) (11-22-2022) | No bands were observed. Does not represent the performance in other kind of samples
|
