CoraLite® Plus 647-conjugated S100A13 Polyclonal antibody

Name: CoraLite® Plus 647-conjugated S100A13 Polyclonal antibody, 100ul
Brand: Proteintech
SKU: CL647-14987-100UL

S100A13 Polyclonal Antibody for IF-P

Cat No. CL647-14987

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

Synonyms

Protein S100 A13, Protein S100-A13, S100 calcium-binding protein A13

Formulation: PBS, Proclin300, BSA, Glycerol

PBS, Proclin300, BSA, Glycerol

Conjugate: CoraLite® Plus 647

Unconjugated CoraLite® Plus 647

Size/Concentration:

SKU:

Freight/Packing: -

Quantity

- +

Filter: AllIF-P

IF Staining of mouse brain using CL647-14987
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using CoraLite® Plus 647 S100A13 antibody (CL647-14987) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Positive IF-P detected in

mouse brain tissue

Application	Dilution
Immunofluorescence (IF)-P	IF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

CL647-14987 targets S100A13 in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag6971 Product name: Recombinant human S100A13 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC000632 Sequence: MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK Predict reactive species
Full Name	S100 calcium binding protein A13
Calculated Molecular Weight	11 kDa
Observed Molecular Weight	11 kDa
GenBank Accession Number	BC000632
Gene Symbol	S100A13
Gene ID (NCBI)	6284
Conjugate	CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths	654 nm / 674 nm
Excitation Laser	Red Laser (633 nm)
Form	Liquid
Purification Method	Antigen Affinity Purified
UNIPROT ID	Q99584
Storage Buffer	PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage Conditions	Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.