S100A14 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• S100A14 Polyclonal antibody (10489-1-AP)

• Featured Product
• KD/KO Validated

S100A14 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10489-1-AP Copied!

Publications (34)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA
For FC, select conjugated version.

Synonyms

Protein S100 A14, Protein S100-A14, S100 calcium-binding protein A14, S100A15, S114

• 

  WB analysis of MCF-7 using 10489-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 10489-1-AP (S100A14 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10489-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10489-1-AP (S100A14 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 10489-1-AP

  WB result of S100A14 antibody (10489-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-S100A14 transfected MCF-7 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of MCF-7 using 10489-1-AP

  IP result of anti-S100A14 (IP:10489-1-AP, 4ug; Detection:10489-1-AP 1:1000) with MCF-7 cells lysate 760 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10489-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10489-1-AP (S100A14 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10489-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10489-1-AP (S100A14 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 10489-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 10489-1-AP (S100A14 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 10489-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 10489-1-AP (S100A14 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human bowen disease using 10489-1-AP

  Immunohistochemical analysis of paraffin-embedded human bowen disease slide using 10489-1-AP (S100A14 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human bowen disease using 10489-1-AP

  Immunohistochemical analysis of paraffin-embedded human bowen disease slide using 10489-1-AP (S100A14 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10489-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10489-1-AP (S100A14 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10489-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10489-1-AP (S100A14 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 10489-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 10489-1-AP (S100A14 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 10489-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 10489-1-AP (S100A14 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 10489-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 10489-1-AP (S100A14 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 10489-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 10489-1-AP (S100A14 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10489-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10489-1-AP (S100A14 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10489-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10489-1-AP (S100A14 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 10489-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using S100A14 antibody (10489-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for S100A14 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MCF-7 cells, rat stomach tissue
• Positive IP detected in: MCF-7 cells
• Positive IHC detected in: human colon cancer tissue, human skin tissue, human ovary tumor tissue, human breast cancer tissue, human bowen disease, human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10489-1-AP targets S100A14 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0757

  Product name: Recombinant human S100A14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-104 aa of BC005019

  Sequence: MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH

• Full Name: S100 calcium binding protein A14
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 10-12 kDa
• GenBank Accession Number: BC005019
• Gene Symbol: S100A14
• Gene ID (NCBI): 57402
• RRID: AB_2183628
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HCY8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The S100 family is a multifunctional group of EF-hand type calciumbinding proteins. S100A14 protein (previously known as BCMP84, S100A15) is a recently identified member of the S100 family. It is differentially expressed in a number of different human malignancies like ovary, breast, uterus, kidney, rectum and colon cancers, and esophageal and oral squamous cell carcinomas (OSCCs).

Publications

What published studies show

The S100A14 Polyclonal antibody (Cat# 10489-1-AP) has 34 citations. These appear in journals including Cell Stem Cell, Molecular Cell, Cell Death & Disease, Cancer Letters, Oncogene, Cell Reports, Oncotarget, Pancreatology, International Journal of Cancer, BMC Cancer, PLoS One, and Thoracic Cancer. Research fields are dominated by oncology—gastric, colorectal, esophageal, oral, nasopharyngeal, thyroid, ovarian, breast, pancreatic, cervical, and lung cancers—focusing on metastasis, prognosis, and signaling pathways, with some work in proteomics and reproductive biology.

Automatically generated from the 34 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Cell Stem Cell; Senolytic-sensitive p16(Ink4a)+ fibroblasts in the tumor stroma rewire lung cancer metabolism and plasticity.; Authors - Jin Young Lee
human	WB	Mol Cell; hRpn13 shapes the proteome and transcriptome through epigenetic factors HDAC8, PADI4, and transcription factor NF-κB p50; Authors - Vasty Osei-Amponsa
human	IF	Cell Death Dis; S100A14 promotes colorectal cancer progression and anti-PD-1 resistance via UPF1-mediated activation of the non-canonical NF-κB signaling.; Authors - Li Tan
human	WB,IHC,IF	Cell Death Dis; Calcium-binding protein S100A14 induces differentiation and suppresses metastasis in gastric cancer.; Authors - Min Zhu
human	WB,IHC	Cancer Lett; Disruption of enhancer-driven S100A14 expression promotes esophageal carcinogenesis; Authors - Xukun Li
human	WB,IP,CoIP	Cell Death Discov; CAV2 promotes the invasion and metastasis of head and neck squamous cell carcinomas by regulating S100 proteins; Authors - Yafei Wang