• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated S100A14 Polyclonal antibody

S100A14 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-10489

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

IF/ICC, FC (Intra)

Protein S100 A14, Protein S100-A14, S100 calcium-binding protein A14, S100A15, S114

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10489 targets S100A14 in IF/ICC, FC (Intra) applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0757

Product name: Recombinant human S100A14 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-104 aa of BC005019

Sequence: MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH

Predict reactive species
Full Name S100 calcium binding protein A14
Calculated Molecular Weight 12 kDa
Observed Molecular Weight 10-12 kDa
GenBank Accession NumberBC005019
Gene Symbol S100A14
Gene ID (NCBI) 57402
RRIDAB_3672445
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9HCY8
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The S100 family is a multifunctional group of EF-hand type calciumbinding proteins. S100A14 protein (previously known as BCMP84, S100A15) is a recently identified member of the S100 family. It is differentially expressed in a number of different human malignancies like ovary, breast, uterus, kidney, rectum and colon cancers, and esophageal and oral squamous cell carcinomas (OSCCs).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 S100A14 antibody CL488-10489Download protocol
IF protocol for CL Plus 488 S100A14 antibody CL488-10489Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...