S100A2 Polyclonal antibody

• 

  WB analysis using 15454-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15454-1-AP (S100A2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 15454-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15454-1-AP (S100A2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human bowen disease using 15454-1-AP

  Immunohistochemical analysis of paraffin-embedded human bowen disease slide using 15454-1-AP (S100A2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human bowen disease using 15454-1-AP

  Immunohistochemical analysis of paraffin-embedded human bowen disease slide using 15454-1-AP (S100A2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 15454-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using S100A2 antibody (15454-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  FC experiment of A431 using 15454-1-AP

  1x10^6 A431 cells were intracellularly stained with 0.4 ug S100A2 Polyclonal antibody (15454-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

S100A2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 15454-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CAN19, Protein S 100L, Protein S100 A2, Protein S100-A2, Protein S-100L

---

Tested Applications

• Positive WB detected in: HaCaT cells, HeLa cells
• Positive IHC detected in: human bowen disease; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells
• Positive FC (Intra) detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

15454-1-AP targets S100A2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7719

  Product name: Recombinant human S100A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-98 aa of BC002829

  Sequence: MMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP

• Full Name: S100 calcium binding protein A2
• Calculated Molecular Weight: 11 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC002829
• Gene Symbol: S100A2
• Gene ID (NCBI): 6273
• RRID: AB_3669209
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P29034
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

S100A2 (S100 calcium-binding protein A2) is also named as S100L and CAN19. S100A2, a member of the S100 protein family, is more highly expressed in endometrial carcinoma tissues than in normal tissues and was correlated with worse survival (PMID: 35042454). S100A2 has a tumor suppressor function. S100A2 is highly upregulated in the epidermis under inflammatory conditions and in drug eruptions, in addition to inflammatory skin diseases such as atopic dermatitis and psoriasis (PMID: 35885660).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Biochem Pharmacol; Targeting BACH1/PSPH axis suppresses bladder cancer progression and gemcitabine resistance by downregulating S100A2 expression; Authors - Tingxuan Ma