Tested Applications
| Positive WB detected in | HaCaT cells, HeLa cells |
| Positive IHC detected in | human bowen disease Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
| Positive FC (Intra) detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15454-1-AP targets S100A2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7719 Product name: Recombinant human S100A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC002829 Sequence: MMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP Predict reactive species |
| Full Name | S100 calcium binding protein A2 |
| Calculated Molecular Weight | 11 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC002829 |
| Gene Symbol | S100A2 |
| Gene ID (NCBI) | 6273 |
| RRID | AB_3669209 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P29034 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
S100A2 (S100 calcium-binding protein A2) is also named as S100L and CAN19. S100A2, a member of the S100 protein family, is more highly expressed in endometrial carcinoma tissues than in normal tissues and was correlated with worse survival (PMID: 35042454). S100A2 has a tumor suppressor function. S100A2 is highly upregulated in the epidermis under inflammatory conditions and in drug eruptions, in addition to inflammatory skin diseases such as atopic dermatitis and psoriasis (PMID: 35885660).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for S100A2 antibody 15454-1-AP | Download protocol |
| IF protocol for S100A2 antibody 15454-1-AP | Download protocol |
| IHC protocol for S100A2 antibody 15454-1-AP | Download protocol |
| WB protocol for S100A2 antibody 15454-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The S100A2 Polyclonal antibody (Cat# 15454-1-AP) has 3 citations. These appear in Cancer Cell, Biochemical Pharmacology, and Nan Fang Yi Ke Da Xue Xue Bao. The associated research fields include pancreatic cancer transcriptomic profiling, bladder cancer progression and gemcitabine resistance via the BACH1/PSPH/S100A2 axis, and hepatocellular carcinoma lactylation-mediated S100A2 transcription promoting proliferation and EMT.
| Species | Application | Title |
|---|---|---|
Cancer Cell Mapping cell type-resolved transcriptomic profiles to patient survival in pancreatic cancer. | ||
Biochem Pharmacol Targeting BACH1/PSPH axis suppresses bladder cancer progression and gemcitabine resistance by downregulating S100A2 expression | ||
Nan Fang Yi Ke Da Xue Xue Bao [Hepatocellular carcinoma-derived lactate-mediated histone H3K18 lactylation modifies S100A2 transcription to promote proliferation, migration, invasion and epithelial-mesenchymal transition of hepatocellular carcinoma cells]. |
