• Featured Product
  • KD/KO Validated

S100A9 Polyclonal antibody

S100A9 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 26992-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

CAGB, Calgranulin B, Calgranulin-B, Calprotectin L1H subunit, CFAG

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHL-60 cells, MCF-7 cells, THP-1 cells
Positive IP detected inMCF-7 cells
Positive IHC detected inhuman breast cancer tissue, human liver cancer tissue, human oesophagus cancer tissue, human tonsillitis tissue, mouse spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells, A549 cells, HepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26992-1-AP targets S100A9 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, sheep
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25764

Product name: Recombinant human S100A9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 25-114 aa of BC047681

Sequence: KLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Predict reactive species
Full Name S100 calcium binding protein A9
Calculated Molecular Weight 13 kDa
Observed Molecular Weight 14 kDa
GenBank Accession NumberBC047681
Gene Symbol S100A9
Gene ID (NCBI) 6280
RRIDAB_2880716
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP06702
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

S100A9 is a calcium binding protein as a member of the S100 family of proteins. S100 proteins are low molecular weight (9 to 14 kDa) intracellular calcium-binding proteins that control key cellular pathways including regulation of the cytoskeleton, cell migration and adhesion, and host oxidative defense. S100A9 may exist as a homodimer, heterodimer with an S100A8 partner (S100A8/A9), or as a heterotetramer with an S100A8 partner(S100A8/A9). S100A8 and S100A9 are found intracellularly in granulocytes, monocytes, and early differentiation stages of macrophages.

Protocols

Product Specific Protocols
IF protocol for S100A9 antibody 26992-1-APDownload protocol
IHC protocol for S100A9 antibody 26992-1-APDownload protocol
IP protocol for S100A9 antibody 26992-1-APDownload protocol
WB protocol for S100A9 antibody 26992-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Res

Comparison of viral RNA-host protein interactomes across pathogenic RNA viruses informs rapid antiviral drug discovery for SARS-CoV-2.

Authors - Shaojun Zhang
humanWB

Cell Rep Med

Discovery of galectin-8 as an LILRB4 ligand driving M-MDSCs defines a class of antibodies to fight solid tumors

Authors - Yiting Wang
mouse

Sci Adv

Gut microbiota from patients with arteriosclerotic CSVD induces higher IL-17A production in neutrophils via activating RORγt.

Authors - Wei Cai
humanCoIP

Theranostics

Pancreatic ductal deletion of S100A9 alleviates acute pancreatitis by targeting VNN1-mediated ROS release to inhibit NLRP3 activation.

Authors - Hong Xiang
  • KD Validated
mouseWB,IHC

Theranostics

Hepatic RACK1 deficiency protects against fulminant hepatitis through myeloid-derived suppressor cells.

Authors - Genyu Liu
mouseWB

Phytomedicine

Geniposide via enema alleviates colitis by modulating intestinal flora and bile acid metabolites, inhibiting S100A8/S100A9/NF-κB, and promoting TGR5 inhibition of NLRP3 inflammasome

Authors - Bao-Xin Zheng
Loading...
||
New chat Able
正在加载,请稍候...