• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated S1PR2 Polyclonal antibody

S1PR2 Polyclonal Antibody for IF-P
Cat No. CL594-21180

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

AGR16, EDG 5, EDG5, Gpcr13, H218, LPB2, S1P receptor 2, S1P receptor Edg 5, S1P2, S1PR2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-21180 targets S1PR2 in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15470

Product name: Recombinant human S1PR2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 283-353 aa of BC069598

Sequence: LNPVIYTWRSRDLRREVLRPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV

Predict reactive species
Full Name sphingosine-1-phosphate receptor 2
Calculated Molecular Weight 353 aa, 39 kDa
Observed Molecular Weight 40-50 kDa
GenBank Accession NumberBC069598
Gene Symbol S1PR2
Gene ID (NCBI) 9294
RRIDAB_2919860
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO95136
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

S1PR2 (sphingosine-1-phosphate receptor 2), also known as as S1P2 or EDG5, is one of five G-protein-coupled receptors for sphingosine-1-phosphate (S1P), a biologically active metabolic product of sphingolipid (PMID: 18787560). S1P and its receptors have important regulatory functions in normal physiology and disease processes, particularly involving the immune, central nervous, and cardiovascular systems (PMID: 21339489). S1PR2 plays a role in acute vascular inflammation (PMID: 23723450). S1PR2 signaling is implicated in STAT3 activation (PMID: 22606352).

Protocols

Product Specific Protocols
IF protocol for CL594 S1PR2 antibody CL594-21180Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...