Home
Products
Primary Antibodies
SALL1 Polyclonal antibody, PBS Only (27761-1-PBS)

Filter: AllIHCIF-P

IHC staining of human placenta using 27761-1-AP (same clone as 27761-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 27761-1-AP (SALL1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27761-1-PBS in a different storage buffer formulation.
IHC staining of human placenta using 27761-1-AP (same clone as 27761-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 27761-1-AP (SALL1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27761-1-PBS in a different storage buffer formulation.
IHC staining of rat testis using 27761-1-AP (same clone as 27761-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 27761-1-AP (SALL1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27761-1-PBS in a different storage buffer formulation.
IHC staining of rat testis using 27761-1-AP (same clone as 27761-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 27761-1-AP (SALL1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27761-1-PBS in a different storage buffer formulation.
IHC staining of mouse testis using 27761-1-AP (same clone as 27761-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 27761-1-AP (SALL1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27761-1-PBS in a different storage buffer formulation.
IHC staining of mouse testis using 27761-1-AP (same clone as 27761-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 27761-1-AP (SALL1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27761-1-PBS in a different storage buffer formulation.
IF Staining of mouse brain using 27761-1-AP (same clone as 27761-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using SALL1 antibody (27761-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 27761-1-PBS in a different storage buffer formulation.
IF Staining of mouse brain using 27761-1-AP (same clone as 27761-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using SALL1 antibody (27761-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 27761-1-PBS in a different storage buffer formulation.

SALL1 Polyclonal antibody, PBS Only

Name: SALL1 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 27761-1-PBS

SALL1 Polyclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 27761-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF-P, Indirect ELISA

Synonyms

HSAL1, Sal 1, Sal like protein 1, SAL1, TBS

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

27761-1-PBS targets SALL1 in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag26766 Product name: Recombinant human SALL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 558-670 aa of NM_001127892 Sequence: MPLPPTLPSLIPFIKTEEPAPIPISHSATSPPGSVKSDSGGPESATRNLGGLPEEAEGSTLPPSGGKSEESGMVTNSVPTASSSVLSSPAADCGPAGSATTFTNPLLPLMSEQF Predict reactive species
Full Name	sal-like 1 (Drosophila)
Calculated Molecular Weight	140 kDa
Observed Molecular Weight	140 kDa
GenBank Accession Number	NM_001127892
Gene Symbol	SALL1
Gene ID (NCBI)	6299
RRID	AB_3742255
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9NSC2
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

SALL1(Sal-like protein 1), also known as SAL1. It is located in the cytoplasm and nucleus. The protein is mainly expressed in the kidney. Transcriptional repressor involved in organogenesis. The protein plays an essential role in ureteric bud invasion during kidney development. The molecular weight of SALL1 is 140 kDa.