SARM1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SARM1 Polyclonal antibody, PBS Only (28625-1-PBS)

• 

  WB analysis using 28625-1-AP (same clone as 28625-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28625-1-AP (SARM1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28625-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 28625-1-AP (same clone as 28625-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28625-1-AP (SARM1 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28625-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 28625-1-AP (same clone as 28625-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28625-1-AP (SARM1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28625-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 28625-1-AP (same clone as 28625-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 28625-1-AP (SARM1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28625-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 28625-1-AP (same clone as 28625-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 28625-1-AP (SARM1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28625-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 28625-1-AP (same clone as 28625-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using SARM1 antibody (28625-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 28625-1-PBS in a different storage buffer formulation.

• 

  FC experiment of SH-SY5Y using 28625-1-AP (same clone as 28625-1-PBS)

  1x10^6 SH-SY5Y cells were intracellularly stained with 0.25 ug SARM1 Polyclonal antibody (28625-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00017). This data was developed using the same antibody clone with 28625-1-PBS in a different storage buffer formulation.

SARM1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 28625-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

EC:3.2.2.-, EC:3.2.2.6, FLJ36296, hSARM1, HsTIR

---

Product Information

28625-1-PBS targets SARM1 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29531

  Product name: Recombinant human SARM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 352-573 aa of NM_015077

  Sequence: EAAIKSLQGKTKVFSDIGAIQSLKRLVSYSTNGTKSALAKRALRLLGEEVPRPILPSVPSWKEAEVQTWLQQIGFSKYCESFREQQVDGDLLLRLTEEELQTDLGMKSGITRKRFFRELTELKTFANYSTCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSLLHRVSEQQLLEDCGIHLGVHRARILTAAREMLHSPLPCTGGKPSGDTPDVFISYRRNSG

• Full Name: sterile alpha and TIR motif containing 1
• Calculated Molecular Weight: 79 kDa
• Observed Molecular Weight: 70-80 kDa
• GenBank Accession Number: NM_015077
• Gene Symbol: SARM1
• Gene ID (NCBI): 23098
• RRID: AB_3086070
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6SZW1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SARM1 (sterile alpha and Toll/interleukin-1 receptor motif-containing 1) is also named as KIAA0524, SAMD2 and SARM. SARM1 is the major pro-degenerative protein in axons (PMID: 32152523). SARM1 is the central executioner of pathological axon degeneration and is an inducible NAD+-cleavage enzyme that is activated by the loss of the NAD+ biosynthetic enzyme NMNAT2 (PMID: 33657413). SARM1 is involved in innate immune response: inhibits both TICAM1/TRIF- and MYD88-dependent activation of JUN/AP-1, TRIF-dependent activation of NF-kappa-B and IRF3, and the phosphorylation of MAPK14/p38 (PMID: 16964262).