SBDS Monoclonal antibody

• Home
• Products
• Primary Antibodies
• SBDS Monoclonal antibody (67200-1-Ig)

• Featured Product
• KD/KO Validated

SBDS Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67200-1-Ig

Clone No.1F8A10

Publications(2)

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

1F8A10, CGI 97, CGI-97, SDS, Shwachman-Bodian-Diamond syndrome protein

• 

  WB analysis using 67200-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67200-1-Ig (SBDS antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 67200-1-Ig

  WB result of SBDS antibody (67200-1-Ig; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SBDS transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 67200-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67200-1-Ig (SBDS antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 67200-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67200-1-Ig (SBDS antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse colon using 67200-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 67200-1-Ig (SBDS antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 67200-1-Ig

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 67200-1-Ig (SBDS antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 67200-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67200-1-Ig (SBDS antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse pancreas using 67200-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 67200-1-Ig (SBDS antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 67200-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 67200-1-Ig (SBDS antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat colon using 67200-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 67200-1-Ig (SBDS antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat pancreas using 67200-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat pancreas tissue slide using 67200-1-Ig (SBDS antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 67200-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67200-1-Ig (SBDS antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 67200-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SBDS antibody (67200-1-Ig, Clone: 1F8A10 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 67200-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using SBDS antibody (67200-1-Ig, Clone: 1F8A10 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67200-1-Ig targets SBDS in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11731

  Product name: Recombinant human SBDS protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-250 aa of BC065700

  Sequence: MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE

• Full Name: Shwachman-Bodian-Diamond syndrome
• Calculated Molecular Weight: 250 aa, 29 kDa
• Observed Molecular Weight: 29-31 kDa
• GenBank Accession Number: BC065700
• Gene Symbol: SBDS
• Gene ID (NCBI): 51119
• RRID: AB_2882493
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y3A5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Shwachman-Bodian-Diamond syndrome (SBDS) is a member of a highly conserved protein family that exists from archaea to vertebrates and plants. The protein may function in RNA metabolism. Mutations within its gene are associated with Shwachman-Bodian-Diamond syndrome.This gene encodes a member of a highly conserved protein family that exists from archaea to vertebrates and plants. The encoded protein may function in RNA metabolism. Mutations within this gene are associated with Shwachman-Bodian-Diamond syndrome. An alternative transcript has been described, but its biological nature has not been determined.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancers (Basel); Nucleolar Stress Functions Upstream to Stimulate Expression of Autophagy Regulators.; Authors - David P Dannheisig ; KD Validated
Human		Cancer Med; Development and validation of a leukocyte-associated immunoglobulin-like receptor-1 prognostic signature for lower-grade gliomas.; Authors - Zhansheng Fang