SBDS Monoclonal antibody, PBS Only

• 

  WB analysis using 67200-1-Ig (same clone as 67200-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67200-1-Ig (SBDS antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67200-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67200-1-Ig (same clone as 67200-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67200-1-Ig (SBDS antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67200-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67200-1-Ig (same clone as 67200-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67200-1-Ig (SBDS antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67200-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67200-1-Ig (same clone as 67200-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SBDS antibody (67200-1-Ig, Clone: 1F8A10 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 67200-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67200-1-Ig (same clone as 67200-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using SBDS antibody (67200-1-Ig, Clone: 1F8A10 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 67200-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SBDS Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67200-1-PBS

Clone No.1F8A10

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

1F8A10, CGI 97, CGI-97, SDS, Shwachman-Bodian-Diamond syndrome protein

---

Product Information

67200-1-PBS targets SBDS in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11731

  Product name: Recombinant human SBDS protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-250 aa of BC065700

  Sequence: MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE

• Full Name: Shwachman-Bodian-Diamond syndrome
• Calculated Molecular Weight: 250 aa, 29 kDa
• Observed Molecular Weight: 29-31 kDa
• GenBank Accession Number: BC065700
• Gene Symbol: SBDS
• Gene ID (NCBI): 51119
• RRID: AB_2882493
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y3A5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Shwachman-Bodian-Diamond syndrome (SBDS) is a member of a highly conserved protein family that exists from archaea to vertebrates and plants. The protein may function in RNA metabolism. Mutations within its gene are associated with Shwachman-Bodian-Diamond syndrome.This gene encodes a member of a highly conserved protein family that exists from archaea to vertebrates and plants. The encoded protein may function in RNA metabolism. Mutations within this gene are associated with Shwachman-Bodian-Diamond syndrome. An alternative transcript has been described, but its biological nature has not been determined.