CoraLite®594-conjugated SBDS Monoclonal antibody

• 

  WB analysis using CL594-67200

  Various lysates were subjected to SDS PAGE followed by western blot with CL594-67200 (SBDS antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  FC experiment of HeLa using CL594-67200

  1x10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite®594-conjugated SBDS Monoclonal antibody (CL594-67200, Clone:1F8A10)(red), or 0.4 ug CoraLite®594 Mouse IgG2a isotype control (11A1B2) (CL594-66360-2, Clone: 11A1B2) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

SBDS Monoclonal Antibody for WB, FC (Intra)

Cat No. CL594-67200

Clone No.1F8A10

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, FC (Intra)

Synonyms

1F8A10, CGI 97, CGI-97, SDS, Shwachman-Bodian-Diamond syndrome protein

---

Tested Applications

• Positive WB detected in: HepG2 cells, HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67200 targets SBDS in WB, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11731

  Product name: Recombinant human SBDS protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-250 aa of BC065700

  Sequence: MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE

• Full Name: Shwachman-Bodian-Diamond syndrome
• Calculated Molecular Weight: 250 aa, 29 kDa
• Observed Molecular Weight: 29-31 kDa
• GenBank Accession Number: BC065700
• Gene Symbol: SBDS
• Gene ID (NCBI): 51119
• RRID: AB_3673516
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y3A5
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Shwachman-Bodian-Diamond syndrome (SBDS) is a member of a highly conserved protein family that exists from archaea to vertebrates and plants. The protein may function in RNA metabolism. Mutations within its gene are associated with Shwachman-Bodian-Diamond syndrome.This gene encodes a member of a highly conserved protein family that exists from archaea to vertebrates and plants. The encoded protein may function in RNA metabolism. Mutations within this gene are associated with Shwachman-Bodian-Diamond syndrome. An alternative transcript has been described, but its biological nature has not been determined. This gene has a closely linked pseudogene that is distally located.