SCLY Monoclonal antibody

• 

  WB analysis using 67606-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67606-1-Ig (SCLY antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 67606-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67606-1-Ig (SCLY antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 67606-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67606-1-Ig (SCLY antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SCLY Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67606-1-Ig

Clone No.3A2G7

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human, rat and More (1)

Applications

WB, IHC, ELISA

Synonyms

3A2G7, EC:4.4.1.16, hSCL, SCL, Selenocysteine lyase

---

Tested Applications

• Positive WB detected in: LNCaP cells, L02 cells, HepG2 cells, K-562 cells, HSC-T6 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

67606-1-Ig targets SCLY in WB, IHC, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28841

  Product name: Recombinant human SCLY protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-231 aa of BC007891

  Sequence: MEAAVAPGRDAPAPAASQPSGCGKHNSPERKVYMDYNATTPLEPEVIQAMTKAMWEAWGNPSSPYSAGRKAKDIINAARESLAKMIGGKPQDIIFTSGGTESNNLVIHSVVKHFHANQTSKGHTGGHHSPVKGAKPHFITSSVEHDSIRLPLEHLVEEQVAAVTFVPVSKVSGQTEVDDILAAVRPTTRLVTIMLANNETGIVMPVPEISQRIKALNQERVAAGLPPILVH

• Full Name: selenocysteine lyase
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC007891
• Gene Symbol: SCLY
• Gene ID (NCBI): 51540
• RRID: AB_2882812
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q96I15
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Nat Struct Mol Biol; PRDX6 augments selenium utilization to limit iron toxicity and ferroptosis; Authors - Hiroaki Fujita