SCLY Monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 67606-1-Ig (same clone as 67606-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67606-1-Ig (SCLY antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67606-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67606-1-Ig (same clone as 67606-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67606-1-Ig (SCLY antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67606-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67606-1-Ig (same clone as 67606-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67606-1-Ig (SCLY antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67606-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP51242-1

  Cytometric bead array standard curve of MP51242-1, SCLY Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67606-2-PBS. Detection antibody: 67606-1-PBS. Standard:Ag28841. Range: 1.563-100 ng/mL.

SCLY Monoclonal Antibody for WB, IHC, Cytometric bead array, Indirect ELISA

Cat No. 67606-1-PBS

Clone No.3A2G7

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

Synonyms

3A2G7, EC:4.4.1.16, hSCL, SCL, Selenocysteine lyase

---

Product Information

67606-1-PBS targets SCLY as part of a matched antibody pair:

MP51242-1: 67606-2-PBS capture and 67606-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28841

  Product name: Recombinant human SCLY protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-231 aa of BC007891

  Sequence: MEAAVAPGRDAPAPAASQPSGCGKHNSPERKVYMDYNATTPLEPEVIQAMTKAMWEAWGNPSSPYSAGRKAKDIINAARESLAKMIGGKPQDIIFTSGGTESNNLVIHSVVKHFHANQTSKGHTGGHHSPVKGAKPHFITSSVEHDSIRLPLEHLVEEQVAAVTFVPVSKVSGQTEVDDILAAVRPTTRLVTIMLANNETGIVMPVPEISQRIKALNQERVAAGLPPILVH

• Full Name: selenocysteine lyase
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC007891
• Gene Symbol: SCLY
• Gene ID (NCBI): 51540
• RRID: AB_2882812
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q96I15
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.