• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated SCP2/SCPx Polyclonal antibody

SCP2/SCPx Polyclonal Antibody for FC (Intra)
Cat No. CL488-23006

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

SCP2, Acetyl-CoA C-myristoyltransferase, EC:2.3.1.155, EC:2.3.1.16, EC:2.3.1.176

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-23006 targets SCP2/SCPx in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19215

Product name: Recombinant human SCP2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 405-547 aa of BC005911

Sequence: MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL

Predict reactive species
Full Name sterol carrier protein 2
Calculated Molecular Weight 547 aa, 59 kDa
Observed Molecular Weight 13-15 kDa
GenBank Accession NumberBC005911
Gene Symbol SCP2
Gene ID (NCBI) 6342
RRIDAB_3672752
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP22307
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

SCP2 (Sterol carrier protein-2), also called nonspecific lipid-transfer protein, is thought to play a major role in intracellular lipid transport and metabolism. Mutations of SCP2 have been associated with diseases involving abnormalities in lipid trafficking, such as Zellweger syndrome. The alternative splicing generates 58 kDa SCPx and 13-15 kDa SCP2 proteins, both of which contain a C-terninal SCP2 domain. In addition to the SCP2 domain, SCPx also contains an amino-terminal thiolase domain. The proteolytic cleavage of SCPx occurred when it was imported into peroxisomes, giving rise to a 44-46 kDa thiolase and a 13-15 kDa SCP2. 23006-1-AP antibody recognizes the 13-15 kDa SCP2 protein.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 SCP2/SCPx antibody CL488-23006Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...