CoraLite® Plus 488-conjugated SCP3 Polyclonal antibody

SCP3 Polyclonal Antibody for FC (Intra)

Cat No. CL488-23024

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

SYCP3, Synaptonemal complex protein 3, SCP-3, SCP 3, COR1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-23024 targets SCP3 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19330

Product name: Recombinant human SYCP3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 13-236 aa of BC062662

Sequence: GKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEVQNMLEGVGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYSQQFLTLFQQWDLDMQKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLF

Predict reactive species
Full Name synaptonemal complex protein 3
Calculated Molecular Weight 236 aa, 28 kDa
Observed Molecular Weight30 kDa, 33 kDa
GenBank Accession NumberBC062662
Gene Symbol SYCP3
Gene ID (NCBI) 50511
RRIDAB_3084071
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8IZU3
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

SYCP3 is an essential structural component of the synaptonemal complex. This complex is involved in synapsis, recombination and segregation of meiotic chromosomes. SYCP3 is required for centromere pairing during meiosis in male germ cells. SYCP3 is also required for normal meiosis during spermatogenesis and male fertility. Mutations in SYCP3 are associated with azoospermia in males and susceptibility to pregnancy loss in females.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 SCP3 antibody CL488-23024Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...