Tested Applications
| Positive WB detected in | mouse testis tissue, HepG2 cells, rat testis tissue |
| Positive IP detected in | mouse testis tissue |
| Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse testis tissue |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
23024-1-AP targets SCP3 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, bovine, duck |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19330 Product name: Recombinant human SYCP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 13-236 aa of BC062662 Sequence: GKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEVQNMLEGVGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYSQQFLTLFQQWDLDMQKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLF Predict reactive species |
| Full Name | synaptonemal complex protein 3 |
| Calculated Molecular Weight | 236 aa, 28 kDa |
| Observed Molecular Weight | 30 kDa, 33 kDa |
| GenBank Accession Number | BC062662 |
| Gene Symbol | SYCP3 |
| Gene ID (NCBI) | 50511 |
| RRID | AB_11232426 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8IZU3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SYCP3 is an essential structural component of the synaptonemal complex. This complex is involved in synapsis, recombination and segregation of meiotic chromosomes. SYCP3 is required for centromere pairing during meiosis in male germ cells. SYCP3 is also required for normal meiosis during spermatogenesis and male fertility. Mutations in SYCP3 are associated with azoospermia in males and susceptibility to pregnancy loss in females.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for SCP3 antibody 23024-1-AP | Download protocol |
| IF protocol for SCP3 antibody 23024-1-AP | Download protocol |
| IHC protocol for SCP3 antibody 23024-1-AP | Download protocol |
| IP protocol for SCP3 antibody 23024-1-AP | Download protocol |
| WB protocol for SCP3 antibody 23024-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
SCP3 Polyclonal antibody (Cat# 23024-1-AP) has 46 citations published in journals including Nature Communications, Nucleic Acids Research, Science Advances, Cell Death & Differentiation, PNAS, Cell Reports, Genes & Development, Development, and eLife. Research fields span meiosis, spermatogenesis, DNA double-strand break repair, germ cell development, testicular toxicology, and male reproductive biology, with applications primarily in IF, WB, and IHC across mouse, human, rat, bovine, and duck species.
| Species | Application | Title |
|---|---|---|
Nat Commun Maternal NAT10 orchestrates oocyte meiotic cell-cycle progression and maturation in mice | ||
Nucleic Acids Res SCF ubiquitin E3 ligase regulates DNA double-strand breaks in early meiotic recombination. | ||
Cell Death Differ Combinatorial tagging generates a multi-purpose knock-in mouse model revealing phase separation-dependent germ granules in RNA homeostasis and germline development | ||
Cell Death Differ NBS1 is required for SPO11-linked DNA double-strand break repair in male meiosis. | ||
Cell Commun Signal Ionizing radiation-induced disruption of Rela-Bclaf1-spliceosome regulatory axis in primary spermatocytes causing spermatogenesis dysfunction |
Reviews
What customers say
Both reviewers rated this antibody 5 stars for immunofluorescence on mouse testis. One user reported excellent detection of meiotic chromosomes on methanol-fixed, fresh-frozen sections at a 1:200 dilution. The other used a 1:50 dilution on mouse testis cells and also gave a top rating. Overall, the antibody is well-regarded for its strong, specific staining of meiotic chromosomes in mouse testis preparations.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Feng-Qian (Verified Customer) (04-03-2020) | It nicely detects meiotic chromosomes on methanol-fixed fresh frozen mouse testis sections.
|
Huizhong (Verified Customer) (08-31-2018) |
 |
