SEC23B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SEC23B Polyclonal antibody, PBS Only (30510-1-PBS)

• 

  WB analysis using 30510-1-AP (same clone as 30510-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30510-1-AP (SEC23B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30510-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 30510-1-AP (same clone as 30510-1-PBS)

  WB result of SEC23B antibody (30510-1-AP; 1:30000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SEC23B transfected HeLa cells. This data was developed using the same antibody clone with 30510-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 30510-1-AP (same clone as 30510-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 30510-1-AP (SEC23B antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30510-1-PBS in a different storage buffer formulation.

• 

  IF Staining of RAW 264.7 using 30510-1-AP (same clone as 30510-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed RAW 264.7 cells using SEC23B antibody (30510-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 30510-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SEC23B Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 30510-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

hSec23B, SEC23 related protein B, SEC23-related protein B

---

Product Information

30510-1-PBS targets SEC23B in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33302

  Product name: Recombinant human SEC23B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-210 aa of BC005404

  Sequence: MATYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPDLPPVQYEPVLCSRPTCKAVLNPLCQVDYRAKLWACNFCFQRNQFPPAYGGISEVNQPAELMPQFSTIEYVIQRGAQSPLIFLYVVDTCLEEDDLQALKESLQMSLSLLPPDALVGLITFGRMVQVHELSCEGISKSYVFRGTKDLTAKQIQDMLGLTKPA

• Full Name: Sec23 homolog B (S. cerevisiae)
• Calculated Molecular Weight: 86 kDa
• Observed Molecular Weight: 80-86 kDa
• GenBank Accession Number: BC005404
• Gene Symbol: SEC23B
• Gene ID (NCBI): 10483
• RRID: AB_3086343
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15437
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.